spacer

EBI Dbfetch

ID   M32490; SV 1; linear; mRNA; STD; MUS; 2018 BP.
XX
AC   M32490;
XX
DT   13-AUG-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mouse Cyr61 mRNA, complete cds.
XX
KW   cyr61 product.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2018
RX   PUBMED; 2355916.
RA   O'Brien T.P., Yang G.P., Sanders L., Lau L.F.;
RT   "Expression of cyr61, a growth factor-inducible immediate-early gene";
RL   Mol. Cell. Biol. 10(7):3569-3577(1990).
XX
DR   MD5; 77f4621e558a2e76174d52ba964444d4.
DR   Ensembl-Gn; ENSMUSG00000028195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029846; mus_musculus.
DR   EuropePMC; PMC2212122; 9449709.
DR   EuropePMC; PMC360792; 2355916.
XX
CC   Draft entry and computer-readable sequence [1] kindly submitted by
CC   L.F.Lau, 02-MAR-1990, for release after publication.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2018
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..2018
FT                   /note="Cyr61 mRNA"
FT   CDS             190..1329
FT                   /codon_start=1
FT                   /note="Cyr61 product"
FT                   /db_xref="GOA:P18406"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR012395"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="MGI:MGI:88613"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18406"
FT                   /protein_id="AAA37512.1"
FT                   /translation="MSSSTFRTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGL
FT                   VRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNS
FT                   RIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVC
FT                   DEDSIKDSLDDQDDLLGLDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHA
FT                   HGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKG
FT                   KKCSKTKKSPEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEM
FT                   FSKNVMMIQSCKCNYNCPHPNEASFRLYSLFNDIHKFRD"
FT   repeat_region   1453..1551
FT                   /note="49 bases repeat"
XX
SQ   Sequence 2018 BP; 500 A; 536 C; 527 G; 455 T; 0 other;
     agaccgtgag cgagagcgcc ccagagaagc gcctgcaatc tctgcgcctc ctccgccagc        60
     acctcgagag aaggacaccc gccgcctcgg ccctcgcctc accgcactcc gggcgcattt       120
     gatcccgctg ctcgccggct tgttggttct gtgtcgccgc gctcgccccg gttcctcctg       180
     cgcgccacaa tgagctccag caccttcagg acgctcgctg tcgccgtcac ccttctccac       240
     ttgaccagac tggcgctctc cacctgcccc gccgcctgcc actgccctct ggaggcaccc       300
     aagtgcgccc cgggagtcgg gttggtccgg gacggctgcg gctgctgtaa ggtctgcgct       360
     aaacaactca acgaggactg cagcaaaact cagccctgcg accacaccaa ggggttggaa       420
     tgcaatttcg gcgccagctc caccgctctg aaagggatct gcagagctca gtcagaaggc       480
     agaccctgtg aatataactc cagaatctac caaaacgggg aaagcttcca gcccaactgt       540
     aaacaccagt gcacatgtat tgatggcgcc gtgggctgca ttcctctgtg tccccaagaa       600
     ctgtctctcc ccaatctggg ctgtcccaac ccccggctgg tgaaagtcag cgggcagtgc       660
     tgtgaagagt gggtttgtga tgaagacagc attaaggact ccctggacga ccaggatgac       720
     ctcctcggac tcgatgcctc ggaggtggag ttaacgagaa acaatgagtt aatcgcaatt       780
     ggaaaaggca gctcactgaa gaggcttcct gtctttggca ccgaaccgcg agttcttttc       840
     aaccctctgc acgcccatgg ccagaaatgc atcgttcaga ccacgtcttg gtcccagtgc       900
     tccaagagct gcggaactgg catctccaca cgagttacca atgacaaccc agagtgccgc       960
     ctggtgaaag agacccggat ctgtgaagtg cgtccttgtg gacaaccagt gtacagcagc      1020
     ctaaaaaagg gcaagaaatg cagcaagacc aagaaatccc cagaaccagt cagatttact      1080
     tatgcaggat gctccagtgt caagaaatac cggcccaaat actgcggctc ctgcgtagat      1140
     ggccggtgct gcacacctct gcagaccaga actgtgaaga tgcggttccg atgcgaagat      1200
     ggagagatgt tttccaagaa tgtcatgatg atccagtcct gcaaatgtaa ctacaactgc      1260
     ccgcatccca acgaggcatc gttccgactg tacagcctat tcaatgacat ccacaagttc      1320
     agggactaag tgcctccagg gttcctagtg tgggctggac agaggagaag cgcaagcatc      1380
     atggagacgt gggtgggcgg aggatgaatg gtgccttgct cattcttgag tagcattagg      1440
     gtatttcaaa actgccaagg ggctgatgtg gacggacagc agcgcagccg cagttggaga      1500
     atgccaaggg gctgatgtgg acggacagca gcgcagccgc agttggagaa gacttcgctt      1560
     catagtactg gagcgggcat tattgctcca tattggagca tgtttacgga tgacgttctg      1620
     ttttctgttt gtaaattatt tgctaagtgt atttttttgc tccagacccc cccccccttt      1680
     cttggttcta caattgtaat agagacaaaa taagattagt tgggccaagt gaaagccctg      1740
     cttgtccttt gacagaagta aatgaaagcg cctctcattc cttcccgagc ggagggggac      1800
     actctgtgag tgtccttggg gcagctacct gcactctaaa actgcaaaca gaaaccaggt      1860
     gttttaagat tgaatgtttt tttatttatc aaagtgtagc ttttggggag ggaggggaaa      1920
     tgtaatactg gaataatttg taaatgattt taattttata tcagtgaaga gaatttattt      1980
     ataaaattaa tcatttaata aagaaatatt tacctaaa                              2018
//


spacer
spacer