spacer

EBI Dbfetch

ID   M32352; SV 1; linear; genomic DNA; STD; MUS; 11231 BP.
XX
AC   M32352;
XX
DT   25-MAY-1990 (Rel. 24, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mouse renin (Ren-1-d) gene, complete cds.
XX
KW   renin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-11231
RX   DOI; 10.1016/0378-1119(89)90143-1.
RX   PUBMED; 2691339.
RA   Burt D.W., Mullins L.J., George H., Smith G., Brooks J., Pioli D.,
RA   Brammar W.J.;
RT   "The nucleotide sequence of a mouse renin-encoding gene, Ren-1d, and its
RT   upstream region";
RL   Gene 84(1):91-104(1989).
XX
DR   MD5; 4b20bb38bd8be4bb6fcb9c33d2433fc3.
DR   EPD; EP15035; MM_RENI.
DR   EPD; EP15036; MM_RENS.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094556; mus_musculus.
DR   RFAM; RF00180; REN-SRE.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11231
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   prim_transcript 1258..10887
FT                   /note="Ren-1-d mRNA and introns"
FT   CDS             join(1286..1377,4697..4847,5364..5487,6056..6174,
FT                   6955..7151,8940..9059,9487..9631,9884..9982,10547..10708)
FT                   /codon_start=1
FT                   /note="renin (Ren-1-d)"
FT                   /db_xref="GOA:P06281"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06281"
FT                   /protein_id="AAA40043.1"
FT                   /translation="MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILE
FT                   ERGVDMTRLSAERGVFTKRPSLINLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTG
FT                   SANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDVVTV
FT                   GGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVF
FT                   SVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEG
FT                   CAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIDEYVVNCSQVPTLPDISFDLGGRAYT
FT                   LSSTDYVLQYPYRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFA
FT                   LAR"
FT   exon            <1286..1377
FT                   /number=1
FT                   /note="renin (Ren-1-d)"
FT   intron          1378..4696
FT                   /note="Ren-1-d intron A"
FT   exon            4697..4847
FT                   /number=2
FT                   /note="renin"
FT   intron          4848..5363
FT                   /note="Ren-1-d intron B"
FT   exon            5364..5487
FT                   /number=3
FT                   /note="renin"
FT   intron          5488..6055
FT                   /note="Ren-1-d intron C"
FT   exon            6056..6174
FT                   /number=4
FT                   /note="renin"
FT   intron          6175..6954
FT                   /note="Ren-1-d intron D"
FT   exon            6955..7151
FT                   /number=5
FT                   /note="renin"
FT   intron          7152..8939
FT                   /note="Ren-1-d intron E"
FT   exon            8940..9059
FT                   /number=6
FT                   /note="renin"
FT   intron          9060..9486
FT                   /note="Ren-1-d intron F"
FT   exon            9487..9631
FT                   /number=7
FT                   /note="renin"
FT   intron          9632..9883
FT                   /note="Ren-1-d intron G"
FT   exon            9884..9982
FT                   /number=8
FT                   /note="renin"
FT   intron          9983..10546
FT                   /note="Ren-1-d intron H"
FT   exon            10547..>10708
FT                   /number=9
FT                   /note="renin"
XX
SQ   Sequence 11231 BP; 2809 A; 2725 C; 3051 G; 2646 T; 0 other;
     ggtacttagg gagagtaata ctgccagcca gggtcaggtc acttcgacag ctctgccagg        60
     cttctgagag gtacagggaa gaaggacagg gggcaaaagg ataggtctaa gggagtgaag       120
     ggccagtagg agggggtcag ctggaagcca gctgcactta agacctcctt tcttttagag       180
     ctacccttct gtccaccatc actaacccag gagggacacc caccctctcc ctgatgccag       240
     aggttagatg acaggttact tttccaacta ggcagcagcc aaaaggaatc actcatgatc       300
     aagatggaag actagggcag agcctaggag gagccagggg tgatttgaag gttaatatag       360
     attaatagat aggttaatat ataatattag gttaatatgc aggtctcggg ggcatgagtt       420
     ggtagggtct gagttagagg tttgaagcca gggtctatgc tgtctgtacc ctgacctcat       480
     gctgaacagc acagctcctc attagcctct gtctaagcta gaggttgcgg ggccaggcca       540
     aacagggact ctagagtcat tgggctcagc cacccttccc acacccccat gcctgccacc       600
     actctgctct gcgaccaggt tctgcttatc ctatacctac ctaacttggt ctcacaggct       660
     agaatttatc aggactgccc tgccatgggc cttgttgggc acctggcatg gggaaataaa       720
     ggaggtgggc gagacctgtg tctcaccaga gctcagagtg actggatggg cagacagcag       780
     gggaaggcac tgggtggtct ggcagctgga aacgctggga ggccttcttg ggggaaatta       840
     gatgaagctc ttcaggggaa ggcctattcc atgactccag catggtgagt ctagatgaaa       900
     ggaggtagtc tatggtttta gagctttatt gtagaagaga gagagagaag gtagagaagt       960
     agatgccagc cattgccacg aagaaggaag ggggagaagg agagcaaaag gtaagagtaa      1020
     gaaaacaaga gctttaggag agagacaaga gagagaggag gaggcaagca gccaggtaac      1080
     tctgggggtg gagtctggac agcctacatg actgatggcc acagaattat ggagctgggt      1140
     ccttggccag aaaacaggct gcctttcatg gtcccacagg ccctggggta ataaatcaaa      1200
     gcagatcctg tgatacatgg tgtgtataaa agaaggctca gggggtctgg gctacacagc      1260
     tcttagaaag ccttggctga accagatgga caggaggagg atgcctctct gggcactctt      1320
     gttgctctgg agtccttgca ccttcagtct cccaacacgc accgctacct ttgaacggta      1380
     acttgggcag agaaggggtg gcagggtaca ggaactggca tcttactaac gccctcagct      1440
     gtctatgcgt tgggtcatcc agtccttttt ggccagccag tcagggatgt atgatcctgc      1500
     tctgacaatc ctagggaata gcccaaagcc ctagtggacg gccataatta aggggtacca      1560
     caacttcccc cttctactac ttttttaaaa ggcgaggggt cactggagtg actgtgtcat      1620
     ttgtggtgaa aattttgggt ggagtggaag tatcagaaga aacatgtagg ccaaaggagt      1680
     aacatgacta tcagttaatt aatctagata gacattaagt tttccttgtg atcatgtaac      1740
     tccccccaag ttcagcagcc gtttggtttg gcgagagagt tcatctgtag ttggaagacc      1800
     tcaagtctgt cctctgtggg gttcagctcg tgtctctgga tctcatgtgt gtcttgggag      1860
     tcttctgtca gatgaggtgt ctggaggaag gcagctttgt ggtctgtagg tctcaggaga      1920
     cctgtctatg ctggatctgc agctgcaggc actgcccttt acttttgtgg ggataaacct      1980
     gtggggtaat cacagcagag gagcagaacc ctagcagcag gatgtctgca tagggtggat      2040
     ggggaacgtt aagcctgcaa tggtttgctt ggaagcacat cctggcctgt tgttaggatc      2100
     ctagaaaagc aagggtgttt gaggaatgta gtcctggaag gcatccttta agtctgcttt      2160
     gggtggctaa ggaggaaaat atcatgttaa ttgtgtatct gggataggca gtaacagatt      2220
     gtctgcaaaa ggaagctggt tgtcagttaa ggattggatg acggtaatca gcatggttaa      2280
     ttcaacccag ggaagcacat tagatggctt ttggccctta aaggaaatca tgaatgctat      2340
     ggagaaaaat aaacattaaa ataaagaagc aagaaaattt tggattgaaa agcttactag      2400
     cagcagatga gggtaagcag caagctaatc tcaccaatcc tcagtccgcc attcaaaaac      2460
     aggatgaaag cagagcctgc ttcaccggct gctttgaaga tttgatgaga ggataagcat      2520
     agcacttccg atgccaggcg gggaccggtg taagaagcca tggttacagc atggattacc      2580
     acagagtgta ggaaagggaa ggctcctggc agccccacga gggaggatga aacagccatt      2640
     tagtgcagtt ccagggctgt aggaacaagg cttcttgagg caggagcagg gcagaggcaa      2700
     gagaaggctc acccagcaat ggtctgggga ctatgatgag gaagtcctga aagagtcaag      2760
     gcaatgagaa ctgtgaatct gcttggtgct taggagctgg tgggttgctt tcatcctaaa      2820
     ttgagtctcc agacagacat cagcacccat gttgcagatg aggatgtcct ccagaaaggt      2880
     ctgaggactc actggtcttt gtttccaaag ccctgccatc ttgctcccag catgcagcag      2940
     agagcgtggg attaactaga gggcgtgggg ttctgtgctc cctgctctgt gtaaagtatt      3000
     gagcaagtca ccttgagggg ctgagcaatg ggctttcttc tcaaggccat tacatgcctt      3060
     gcatacacac aatgtccagc ctccacgctt agcctgagct gtgcctgggc gaaaaaacca      3120
     tcaaggtgcc agaggacgaa gaggttagtg aatgctcaga accgtgcagc atgccctcag      3180
     catcaggtgg ctctatcccc gttgtccctg taggctaggc ttgtggggag cactcagggg      3240
     aaatggaccc attggctggc atccttggtg agagcaccta ggtatgggct caggtcttga      3300
     aacattaagg atctaggaga ggaatagaag gggttttatg tttattttct tttgggacag      3360
     agcctcatta tggagcctgg aactcactat atagaccaga ctggcctcaa acccacagag      3420
     atcagccttc ctctgcctcc tgaggactga aattaatgtc atgccctacc acacaacaga      3480
     gaggttttct aaaagaagga agggtcataa aagaaacagc aagcattggg tctttttcag      3540
     gaaattggtg gagaactaga cctgtcttcc tcccttgaag agtggggaaa taaaacacac      3600
     ccatctggtg agatggctgg ggtcaactaa cacaagagtg gaaatacttg caagccgtgc      3660
     taggactaag tcatttctgc tggagattac tcggataggt gtgaaatatg ggcaaagctg      3720
     ggaggtgagg cacggagtgc tgggaggaag gttagggctc acactggaga agaaagaggg      3780
     ctctctggat gtctgggaaa gccctggctc aggactggtg gcatcttcct ccaactgcaa      3840
     aacagtctgt gtggtcccgg cagtcctggg taggaaagac agacagacag agcttggact      3900
     gtctctgttt ggcatttctg agtcatcttc atccttgtga accttcaatg tctccgccac      3960
     caccgccgga aaccagggag ctagatgtca tgtggtttgt atgagggtgc gtgccaggca      4020
     gctggcctgc ggccaggagt agctcaggga gctgctgttc taaatgaaat ctcttgaatt      4080
     ttgccagtca ataatgattg gaggtgagga ggggcccagg attcaggccc aagacacatc      4140
     agtccccagg tgaggcacac cggcaagcta tagacactgg cctatccaat ccaagtcaag      4200
     ctaggttcat tgggcacata tcacctggct ctgtgatacc ccagggagca acaagtcctt      4260
     gcagcctgct gtgggcatct gctgccactt acaggccatc cgtggtactg ccttgcccgt      4320
     caatccaagg agatggcaag aggctgtata gaccttttat gttcctctcc agaacagtga      4380
     ggaagagtag gtgttcaaca cacgatgatg ataatggtag atagatgaac agacggactg      4440
     actgatgaac agacgggtgg atggacagac ggatggacgg atgaacaaac tgctttatct      4500
     aactaaaata agatctggga attacttagt accagaataa gtgactccaa gaaaccccag      4560
     ggaactaaaa gtgattcgta attgcaatgg gagagggtta gtgttagacg taccaaaaag      4620
     caaggcaaca tctgggctct gtcaacgttg gagcactgca cgactcttct gtttttcttt      4680
     ctctaccctg gagcagaatc ccactcaaga aaatgccctc tgtccgggaa atcctggagg      4740
     agcggggagt ggacatgacc aggctcagtg ctgaaagggg cgtattcaca aagaggcctt      4800
     ccttgatcaa tcttacctcc cccgtggtcc tcaccaacta cctgaatgtg agtcctggct      4860
     catctgctat ctccttttct ctctgggact agcaggctcc cactccttcc acaccatgtt      4920
     tgactgagag ccaaagagca ccccatagaa ctcctattta ccagccgaga agtctgatgg      4980
     ggaggggctg ttgtgattgt tttgttgttt ggtttggttt gtttttgaga cagggtctca      5040
     ctgtgtagcc tggcaagcct ggaactcact ttgtagacca gactgacctc gaactcacag      5100
     agttctacct acctctgcct cccaggtgct gggattaaag catgtgacat catgcccagc      5160
     aattttaatt gctttgatta agcttgcccc agcaagcctc ctgtatccca ggccagcaaa      5220
     agacaatgct gagtcctcac atctcagcaa aaagaaagcc aagagccgag aaggggtcca      5280
     gacaaccccc caaaccagag gccccaagcc ctgaagtcac ccccatctct ctgggcccca      5340
     ttttcctttt gcccccgcca cagacccagt actacggcga gattggcatc ggtaccccac      5400
     cccagacctt caaagtcatc tttgacacgg gttcggccaa cctctgggtg ccctccacca      5460
     agtgcagccg cctctacctt gcttgtggta agagtcaaga gtcagcctcg tgcctctccc      5520
     cagctctgcc tgctgcacct atgacctgct tctcctcagc tccacaccac tgactgagga      5580
     agagagagga agtgtctctc ttctttttga aatggcagcc aagttaataa gccagctttg      5640
     ggaatgcctg ggcacctgga aggccttttg ccatgtccca aggattcaga caggaacaaa      5700
     gtgtaaaccc actccaggtc ttgaggcttt ttcgatgctc ccatgctgag tacttactct      5760
     gtgcccagaa tcctctttag cactatatca gtgttagcaa tggctttaga actctgtgaa      5820
     aaaaatgtct cagaaagcac gagcacataa gacgaaaaca aaaaaaacca ctatccttgc      5880
     ctggtttaca tttttccaag ctggagactc aggaaactaa acacacacac acacacacac      5940
     acacacacac acacacacct aagtcttcaa ccatgtttat catttgtcct gcctctgagc      6000
     cttctatgta aatcaatctc tcttgtgctg actggggcct gtaaccctct gctagggatt      6060
     cacagcctct atgagtcctc tgactcctcc agctacatgg agaacgggtc cgacttcacc      6120
     atccactacg gatcaggaag agtcaaaggc ttcctcagcc aggacgtggt gactgtgagt      6180
     aggatcgcct ctatttacca cagggcccat gtggttccag acaggtatac tccagccctc      6240
     ctccctaccc ctcccactcc tctgcaggag cctgggaagt tgaagtgcag cctccttggc      6300
     agcttcttct agctgaagct ccgaagccaa ttgcaggaga gccaaacctg ctgacactga      6360
     tgcacaaggc tttgcatcta acttgcatgt ggatgtgtgc ctaaacccca cagtttcctt      6420
     cctagtaacc agtctgactt tgctaattga gaccaggttt ggagtactga gattaggaat      6480
     caggggtttg tgtccgggca gttttgattt ctttccttca gtgtctaagc ctgttctggc      6540
     atatctcagc cccgctgtgt cagaggaaga gaaagacaca tacagaggtc agaggaaatc      6600
     agtgcgagcc cttccctcgc actgcccccg cggaatctgg ggagggcaga aggagccctg      6660
     gtaatgacga ggcatcctca gcctcggctg gtgggctagc acgaaagcgg gcctctagga      6720
     gagttccggt cacctgtctg gcaggacctc tttctcagcc tttatagcat gagtcacccc      6780
     catctctctg ggccccaagc atagaggtgt tgtcagtgtg tgtgcagact tgacggaata      6840
     gtcttaactg ctgtacagag cgtgtgtatc tctgctgccc tggtatgaaa gccagagcag      6900
     atcccagcca aggttaggca gtaacctatg tcccttctgg ttcttctctc acaggtgggt      6960
     ggaatcactg tgacacagac ctttggagag gtcaccgagc tgcccctgat ccctttcatg      7020
     ctggccaagt ttgacggtgt cctaggcatg ggctttcctg ctcaggccgt tggcggggtt      7080
     acccctgtct ttgaccacat tctctcccag ggggtgctga aggaggaagt gttctctgtc      7140
     tactacaaca ggtgggcctt tgacaccaag gccagggcag ggaggggtgg agagcaggga      7200
     gagcagccac cgtccagttc aggatttata tgcttctaat taggtggttc tcagtcccca      7260
     tctagaacca cagtagccaa ttagaacaaa tggaagtcaa gcattcggtc cccagggact      7320
     ggccacacag acacagccag cttcatgcct ttgtttatct gttctcattg atccggttag      7380
     tgctctgtta ccatgtgcta tggtaggctc caggggtgga cagtgaacag acgacccctg      7440
     ccctccatcc tcacagagct cactgcccag caggggagat gagaggtaca acacaatgag      7500
     tgccattcta aagctgcaga tggttttcag ttctaggcca ggattctggg cagttcagcc      7560
     aggcctgggg aaactgtggt cagtgcccca gcaggggtgg gatctgctgc cagtggctgg      7620
     gtttagaaat atggtctaag ctggaggtaa gatctttacg ggtaagaata gaggccaggg      7680
     gtggtgagag tggaagggag tggtgtcctg gaacaatctt agaggaagca ggagtctctg      7740
     gatcatgact ctggcagact tctgtgcaaa gaggggcatt gagccaatga caccactcgg      7800
     aggctcctgc agtcaatggt cttgggactg tgtttcaaag agaccagaaa aacaaagtgt      7860
     ctaagagtgg aagtagatgt cagaaagggg gaggggggac tccgcaaaat gtgggcagtt      7920
     ctggaaattc aacagggaag gagatgtggg gcagagaagc gggagagggg aggtgggtgc      7980
     tctaaacgct agaggatgct tgagcaatgc tgtgggtgga agaaggagag ctgtggaaaa      8040
     cacatgcatg aggctgagaa gcaggagccc tggaagggat gaggacccag caacaggtag      8100
     caagcagtcc tgggaagcag agacctgctt cctttccctt gggctgggaa gaaaggaaga      8160
     tctagataag tcactgactc ttgcacagaa cctgtgtaca cctaacccat gtacatatgt      8220
     gcacatacaa atgtgtgttg tgaattctaa gaaactccat catatacaca tgagtatctt      8280
     aaaaccaccc aaggcaatcc tgagcttagg tagcatcatg cccgtggaga gagaagtgag      8340
     ggtagtcagc tctggctggg aaggagagcc tggctccagc catttggtga ctcagttgcc      8400
     tggggggggg gggtgtgaaa attaacctct accaaacaag ggttgctgat tctttcctac      8460
     gaagtctccc ctctgtgtcc ctctttgcct cagcagaaat ctcaaggagg gaggagcccc      8520
     atatggcccc aaagctccaa tacttcccag acccttaccc tggaatgata cccaccaccc      8580
     acacactcca ttcatccagg cccaactcca ctaaatgtct gccttctccc tagtgtccac      8640
     atgcccagga aagacgtgat ttgccacttg tctgcatcta cccaatgtcc ttgagctaga      8700
     cagttttctg ggtgcaggtg aacagtccta gaaatacttc tgttacattt agggaggatc      8760
     cagcaaggga agatgcaatg gggtctgtgt gcctcctgat gacagcttac agccttgcca      8820
     tctacccact aaacccttcc tctatcccaa agtcctctgc cctaccccac accagactct      8880
     actctccttc atccctgtat ctcgggtatg tctctaactt ccaatgttct ttcctttagg      8940
     ggttcccacc tgctgggggg cgaggtggtg ctaggaggca gtgacccgca gcattaccaa      9000
     ggcaattttc actatgtgag catcagcaag actgactcct ggcagatcac gatgaagggg      9060
     tgggtcagca agcgtaactc tcccaaccat gcaaactgat gtcactgtgt gattggggtg      9120
     ggctgggaat gggatgaggg ggacacttct tagggcacag ccaccatctg cctctctgct      9180
     tgctctgtcc taggatgggg gcatgaaaat ttgaggatgg gaaggaaggg actcagggaa      9240
     aggaggggga gtccggaggc tacatgctga tgcaaggaac agttagtacc tttccatagt      9300
     gtctcggccc tcttccagtt catcatcaga ccatgtatgg cctcctatca cactacccta      9360
     aattgggaaa ggcatgcagg cggcgggaaa agggtgcccg acagcttcta cctgcctgcc      9420
     ttgtctgtct gtctgactgt ctgcctgcct gcctgcctgc ctgccagtct aactatagct      9480
     ctgcagggtg tctgtggggt cttccaccct gctatgtgaa gaaggctgtg cggtagtggt      9540
     ggacactggt tcatccttta tctcggctcc tacgagctcc ctgaagttga tcatgcaagc      9600
     cctgggagcc aaggagaaga gaatagatga agtaagagat ccgtggggag ggctgggtgg      9660
     tggtgagggg tggcagcagc actgtgcggc tccagcctgc aaatcgtcca gacagcactg      9720
     gatcggaaac aaagctttcc cctcctcccc tctcccaccc cctgaatgta tggcatgtct      9780
     tccatagaag gtgaccagag actggcacag gctctctggc acagggtgct ctagtctgct      9840
     tcgaagcttt ccaccctgac aacccctctc tttattcccc cagtatgttg tgaactgtag      9900
     ccaggtgccc accctccccg acatttcctt tgacctggga ggcagggcct acacactcag      9960
     cagtacggac tacgtgctac aggtgaggct gggacaaggg tgggcagggg cactgaaggg     10020
     ggacaagtgt aatgtacaga tcccccagta gactcgtggt tgatgaatac ggctcatgtc     10080
     atcatctgga gaatttttag cagtcccagt acccaggcca catacaagtc tcgcctagca     10140
     gatcggagct tccacaacag gcatctggga atcagagttt taaaacgact tccccagtag     10200
     gttccattat gaagctctgc tgtgactcag tgagccccct ctctccatta ttgagtagcc     10260
     ctctttctag tcctccatcc ttttcatgct cccaggctta gagaagttca atgacttgtt     10320
     ttgggtcaga agctaagtga gcccgtgagc aaggggtaga cacaccattt gcctgatacc     10380
     tactacagtg cctgcctacc ccaggaaggc tgggatttag gataggtaaa acagttctgg     10440
     gaggatgtag gagagaggag gcatatactg aagagctgtt gcttcactct ggaggtggga     10500
     atgcgttgtg tggcgggcag tagagcaagc ctctgcttct tgccagtatc cctacaggag     10560
     agacaagctg tgcacactgg ctctccatgc catggacatc ccaccaccca ctgggcctgt     10620
     ctgggtcctg ggtgccacct tcatccgcaa gttctataca gagtttgatc ggcataacaa     10680
     tcgcattgga ttcgccttgg cccgctaagg ccctctgcca cccagtaacc ctaggccaag     10740
     ccaagctggc actcctgggg gccattttgt ctggctttgt ccccaacata gggacactgg     10800
     acacagagac cctaacgagt gtttgcccct tcacctgcac tcacccttcc ctgctttaag     10860
     gaaaaaccga ataaagattt catgtttaaa gcctgtttcg gatgggttct ttggagtttg     10920
     gaggaggtac acctgcatgg tcacacgtgg agaagactat gacacgtgag gccagagatg     10980
     gaggtttgtt agtaaagtgc ttgcttttca agtgtgagaa cctgagtttg attccaggaa     11040
     cccacactaa aaccaacaaa caaacaaaca gggctggaga gatggctcag tagttaagtg     11100
     cactgagtgt tcttcctgat gtccttgcgt tcaattccca gcaacacacg tggtggctca     11160
     caaccatgtg tatggggtct gatgccctct tctggcatgt ctaagagagt gataatgtac     11220
     tcctaattaa t                                                          11231
//


spacer
spacer