spacer

EBI Dbfetch

ID   M28584; SV 1; linear; mRNA; STD; HUM; 1091 BP.
XX
AC   M28584;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 20)
XX
DE   Human (clone DHO-8) MHC class II DR subtype Dw12 mRNA, 3' end, haplotype
DE   HLA-DR2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane glycoprotein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1091
RX   PUBMED; 3571980.
RA   Wu S.K., Yabe T., Madden M., Saunders T.L., Bach F.H.;
RT   "cDNA cloning and sequencing reveals that the electrophoretically constant
RT   DR beta 2 molecules, as well as the variable DR beta 1 molecules, from
RT   HLA-DR2 subtypes have different amino acid sequences including a
RT   hypervariable region for a functionally important epitope";
RL   J. Immunol. 138(9):2953-2959(1987).
XX
DR   MD5; 6eda085701840007fe7fea85f510af74.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   On Sep 21, 1994 this sequence version replaced gi:341965.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1091
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-DR2"
FT                   /cell_line="Epstein-Barr virus transformed lymphoblastoid
FT                   cell line LCL"
FT                   /tissue_lib="of Sasazuki"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     <1..58
FT                   /gene="HLA-DRB2"
FT                   /note="G00-120-643"
FT   CDS             <1..773
FT                   /codon_start=2
FT                   /gene="HLA-DRB2"
FT                   /product="MHC class II DR-beta"
FT                   /db_xref="GOA:P01911"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*15:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01911"
FT                   /protein_id="AAA59681.1"
FT                   /translation="CMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRF
FT                   LDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
FT                   GESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVS
FT                   TGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGV
FT                   GGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     59..769
FT                   /gene="HLA-DRB2"
FT                   /product="MHC class II DR-beta"
FT                   /note="G00-120-643"
FT   regulatory      1066..1071
FT                   /gene="HLA-DRB2"
FT                   /note="G00-120-643"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1091
FT                   /gene="HLA-DRB2"
FT                   /note="G00-120-643"
XX
SQ   Sequence 1091 BP; 241 A; 286 C; 316 G; 248 T; 0 other;
     ctgcatgaca gcgctgacag tgacactgat ggtgctgagc tccccactgg ctttgtctgg        60
     ggacacccga ccacgtttcc tgtggcagcc taagagggag tgtcatttct tcaatgggac       120
     ggagcgggtg cggttcctgg acagatactt ctataaccag gaggagtccg tgcgcttcga       180
     cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgacg ctgagtactg       240
     gaacagccag aaggacatcc tggagcaggc gcgggccgcg gtggacacct actgcagaca       300
     caactacggg gttggtgaga gcttcacagt gcagcggcga gtccaaccta aggtgactgt       360
     atatccttca aagacccagc ccctgcagca ccacaacctc ctggtctgct ctgtgagtgg       420
     tttctatcca ggcagcattg aagtcaggtg gttcctgaac ggccaggaag agaaggctgg       480
     gatggtgtcc acaggcctga tccagaatgg agactggacc ttccagaccc tggtgatgct       540
     ggaaacagtt cctcgaagtg gagaggttta cacctgccaa gtggagcacc caagcgtgac       600
     aagccctctc acagtggaat ggagagcacg gtctgaatct gcacagagca agatgctgag       660
     tggagtcggg ggctttgtgc tgggcctgct cttccttggg gccgggctgt tcatctactt       720
     caggaatcag aaaggacact ctggacttca gccaacagga ttcctgagct gaaatgcaga       780
     tgaccacatt caaggaagaa ctttctgccc cggctttgca ggatgaaaag ctttcctgct       840
     tggcagttat tcttccacaa gagagggctt tctcaggacc tggttgctac tggttcggca       900
     actgcagaaa atgccctccc ttgtggcttc ctcagctcct gcccttggcc tgaagtccca       960
     gcattgatgg cagcgctcat cttcaagttt tgtagtcccc tttagcctga accgtatggc      1020
     ctcccgtgga tctgtattca ccctgtatga caaacacatt acattattaa atgtctctca      1080
     aagatggagt t                                                           1091
//


spacer
spacer