Dbfetch

ID   M28583; SV 1; linear; mRNA; STD; HUM; 1033 BP.
XX
AC   M28583;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 20)
XX
DE   Human (clone FJ0-1) MHC class II DR subtype Dw2 mRNA, complete cds,
DE   haplotype HLA-DR2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane glycoprotein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1033
RX   PUBMED; 3571980.
RA   Wu S.K., Yabe T., Madden M., Saunders T.L., Bach F.H.;
RT   "cDNA cloning and sequencing reveals that the electrophoretically constant
RT   DR beta 2 molecules, as well as the variable DR beta 1 molecules, from
RT   HLA-DR2 subtypes have different amino acid sequences including a
RT   hypervariable region for a functionally important epitope";
RL   J. Immunol. 138(9):2953-2959(1987).
XX
DR   MD5; 654716b2dbb1b63a24b9e183bd2afff0.
XX
CC   On Sep 21, 1994 this sequence version replaced gi:341964.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1033
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-DR2"
FT                   /cell_line="Epstein-Barr virus transformed lymphoblastoid
FT                   cell line LCL"
FT                   /tissue_lib="of Betuel"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     40..126
FT                   /gene="HLA-DRB2"
FT                   /note="G00-120-643"
FT   CDS             40..840
FT                   /codon_start=1
FT                   /gene="HLA-DRB2"
FT                   /product="MHC class II DR-beta"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="H-InvDB:HIT000195243.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAA59680.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     127..837
FT                   /gene="HLA-DRB2"
FT                   /product="MHC class II DR-beta"
FT                   /note="G00-120-643"
XX
SQ   Sequence 1033 BP; 217 A; 278 C; 309 G; 229 T; 0 other;
     cctgcttctc tggcccctgg tcctgtcctg ttctccagca tggtgtgtct gaagctccct        60
     ggaggctcct gcatgacagc gctgacagtg acactgatgg tgctgagctc cccactggct       120
     ttggctgggg acacccgacc acgtttcctg tggcagccta agagggagtg tcatttcttc       180
     aatgggacgg agcgggtgcg gttcctggac agatacttct ataaccagga ggagtccgtg       240
     cgcttcgaca gcgacgtggg ggagtaccgg gcggtgacgg agctggggcg gcctgacgct       300
     gagtactgga acagccagaa ggacttcctg gaagacaggc gcgccgcggt ggacacctac       360
     tgcagacaca actacggggt tggtgagagc ttcacagtgc agcggcgagt ccaacctaag       420
     gtgactgtat atccttcaaa gacccagccc ctgcagcacc acaacctcct ggtctgctct       480
     gtgagtggtt tctatccagg cagcattgaa gtcaggtggt tcctgaacgg ccaggaagag       540
     aaggctggga tggtgtccac aggcctgatc cagaatggag actggacctt ccagaccctg       600
     gtgatgctgg aaacagttcc tcgaagtgga gaggtttaca cctgccaagt ggagcaccca       660
     agcgtgacaa gccctctcac agtggaatgg agagcacggt ctgaatctgc acagagcaag       720
     atgctgagtg gagtcggggg ctttgtgctg ggcctgctct tccttggggc cgggctgttc       780
     atctacttca ggaatcagaa aggacactct ggacttcagc caacaggatt cctgagctga       840
     aatgcagatg accacattca aggaagaact ttctgccccg gctttgcagg atgaaaagct       900
     ttcctgcttg gcagttattc ttccacaaga gagggctttc tcaggacctg gttgctactg       960
     gttcggcaac tgcagaaaat gtcctccctt gtggcttcct cagctcctgc ccttggcctg      1020
     aagtcccagc att                                                         1033
//