Dbfetch

ID   M27073; SV 1; linear; mRNA; STD; MUS; 2243 BP.
XX
AC   M27073;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus protein phosphatase 1 (dis2m2) mRNA, complete cds.
XX
KW   protein phosphatase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2243
RX   DOI; 10.1016/0092-8674(89)90338-3.
RX   PUBMED; 2544298.
RA   Ohkura H., Kinoshita N., Miyatani S., Toda T., Yanagida M.;
RT   "The fission yeast dis2+ gene required for chromosome disjoining encodes
RT   one of two putative type 1 protein phosphatases";
RL   Cell 57(6):997-1007(1989).
XX
DR   MD5; 1070f7cfb4fa2cef250485731b38bb7c.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
DR   EuropePMC; PMC29359; 11172053.
DR   EuropePMC; PMC33252; 11320206.
XX
CC   On Apr 14, 1994 this sequence version replaced gi:341620.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2243
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="14-day-old"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   gene            1..2243
FT                   /gene="dis2m2"
FT   CDS             96..1079
FT                   /codon_start=1
FT                   /gene="dis2m2"
FT                   /product="protein phosphatase 1"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="AAA37527.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2243 BP; 633 A; 398 C; 475 G; 736 T; 1 other;
     aaacgccgcg tgactcgtag gtgagaacgc cgagccgccg ccgccgccga gaagccctgt        60
     taacgcttta gggaggagag tctggtgccg acaagatggc ggacggggag ctgaacgtgg       120
     acagcctcat cacccgcctg ctggaggtac gaggatgtcg tccaggaaag attgtacaaa       180
     tgactgaagc agaagtccga gggttgtgta tcaagtctcg tgaaatcttt ctcagccagc       240
     ctattctttt ggaattggaa gcaccactga agatttgtgg agacattcat ggacaatata       300
     cagacttact aagattattt gaatatggag gttttccacc agaagccaac tatcttttct       360
     taggagatta tgtggacaga ggaaagcagt ctttggaaac catctgtttg ctattggctt       420
     acaaaatcaa atacccggag aacttctttc ttctaagagg aaaccatgag tgtgctagca       480
     tcaatcgcat ttatggattc tacgatgagt gtaaacgaag atttaatatt aaattgtgga       540
     agacattcac tgattgtttt aactgtctgc ctatagctgc tattgttgat gagaaaatct       600
     tctgttgtca tggaggactg tcaccagacc tacaatctat ggaacagatt cggagaatta       660
     tgagacccac tgacgtacct gatacaggtt tgctttgtga cttactgtgg tccgacccag       720
     ataaggatgt gcaaggctgg ggagaaaatg accgtggtgt ttcttttact tttggagctg       780
     atgtagtcag taaatttctg aatcgtcatg atttagactt gatttgtcga gctcatcagg       840
     tggtggaaga cggatatgaa ttttttgcta aacgacagtt ggtaacctta ttttctgccc       900
     caaattactg tggcgagttt gacaatgctg gtggtatgat gagtgtggat gagactttga       960
     tgtgttcatt ccagatattg aaaccatctg aaaagaaagc taagtaccag tatggtgggc      1020
     tgaattctgg acgtcctgtc actccgcctc gaacagctaa tccaccgaag aaaaggtgaa      1080
     gacaggaatt ctagaaagag aaaccatcag atttgttaag gacatacttc ataatatata      1140
     agtgtgcact gtaaaaccat ccagccattc gacacccttt atgatgtcac acctttaact      1200
     taaggagacg gtaaaggatc ttaaattttt ttctaataga aagatgtgct acactgtatt      1260
     gtaataagta tactctgtta taatattcaa caaaattaaa tccaaattca aaagtatcca      1320
     ttaaagttct atcttctcat atcacagttt ttaaagttga aaagcatccc agttaaacta      1380
     gccctgttag tgacccagat gaaagcatga agatccatct gtgtaatgtg gttttagtgg      1440
     tgcttggttg tttcattatt ttgagcttgt tttgttttgt ttgtttttgc tagaataatg      1500
     gcatctactt ttcctatttt tccctaaaca tttttaaaag tgaaaatggg aagagcttta      1560
     aagacattca ccaactattc ttttccttta cttatctact taagtaactg ttggatctta      1620
     ctaagaaaac ttacccctca ttacagtaaa aaggaacttt agaggtcgat aggttttaaa      1680
     aatatacaaa ctatctgatc cattgatttt aatcaaacag tttgactggg caaactttgc      1740
     agctgataat gagtatttcg ctttttacaa aattgccact gatttggatt tgtgcactct      1800
     aatctttaat ttattgatgc tctattgtgc agtagcattt catttaagat aaggctcata      1860
     tagtaatatc caaaactagt tggtaatgtg attatgtggt actttggctt tgggttctna      1920
     ttcgcacgaa acaccttttg gcatgcttaa ctttctggta ttaccctcac ctgcattggt      1980
     tttgtttttt ggggtttttg ttgtttgttt gtttttagat tcacagaaca tgagaatcct      2040
     ttttgacaag ccttggatag ctggctctct tctttccctc tctctatgtg aaggatgtat      2100
     ttaaatgaac gctggtcagt gggacatttg tcagctctga atattgggtg cttcactaat      2160
     aattgccatg tgaatgttgt tttgactgta aggctatgtc actaaagatt tttactctgc      2220
     gttttcataa tcaaaggtca tga                                              2243
//