spacer

EBI Dbfetch

ID   M26331; SV 1; linear; genomic DNA; STD; HUM; 3103 BP.
XX
AC   M26331;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Human tumor necrosis factor gene, complete cds.
XX
KW   tumor necrosis factor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3103
RX   DOI; 10.1111/j.1432-1033.1985.tb09226.x.
RX   PUBMED; 3932069.
RA   Marmenout A., Fransen L., Tavernier J., Van Der Heyden J., Tizard R.,
RA   Kawashima E., Shaw A., Johnson M.-J., Semon D., Mueller R.,
RA   Ruysschaert M.-R., Van Vliet A., Fiers W.;
RT   "Molecular cloning and expression of human tumor necrosis factor and
RT   comparison with mouse tumor necrosis factor";
RL   Eur. J. Biochem. 152(3):515-522(1985).
XX
DR   MD5; e3d58f7a5946c513f11d351abdde5a89.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3103
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     362..1403
FT                   /note="tumor necrosis factor signal peptide"
FT   CDS             join(570..755,1362..1407,1595..1642,1944..2365)
FT                   /codon_start=1
FT                   /note="tumor necrosis factor precursor"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:5TSW"
FT                   /protein_id="AAA36758.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   exon            <570..755
FT                   /number=1
FT                   /note="tumor necrosis factor precursor"
FT   sig_peptide     570..755
FT                   /note="tumor necrosis factor signal peptide"
FT   prim_transcript 570..2365
FT                   /note="tumor necrosis factor mRNA and introns"
FT   intron          756..1361
FT                   /note="TNF intron A"
FT   exon            1362..1407
FT                   /number=2
FT   mat_peptide     1404..1407
FT                   /note="tumor necrosis factor protein"
FT   intron          1408..1594
FT                   /note="TNF intron B"
FT   mat_peptide     1595..1642
FT                   /note="tumor necrosis factor protein"
FT   exon            1595..1642
FT                   /number=3
FT   intron          1643..1943
FT                   /note="TNF intron C"
FT   mat_peptide     1944..2362
FT                   /note="tumor necrosis factor protein"
FT   exon            1944..>2365
FT                   /number=4
FT                   /note="tumor necrosis factor precursor"
XX
SQ   Sequence 3103 BP; 784 A; 781 C; 880 G; 658 T; 0 other;
     atcctgtctg gaagttagaa ggaaacagac cacagacctg gtccccaaaa gaaatggagg        60
     caataggttt tgaggggcat ggggacgggg ttcagcctcc agggtcctac acacaaatca       120
     gtcagtggcc cagaagaccc ccctcggaat cggagcaggg aggatgggga gtgtgagggg       180
     tatccttgat gcttgtgtgt ccccaacttt ccaaatcccc gcccccgcga tggagaagaa       240
     accgagacag aaggtgcagg gcccactacc gcttcctcca gatgagctca tgggtttctc       300
     caccaaggaa gttttccgct ggttgaatga ttctttcccc gccctcctct cgccccaggg       360
     acatataaag gcagttgttg gcacacccag ccagcagacg ctccctcagc aaggacagca       420
     gaggaccagc taagagggag agaagcaact acagaccccc cctgaaaaca accctcagac       480
     gccacatccc ctgacaagct gccaggcagg ttctcttcct ctcacatact gacccacggc       540
     tccaccctct ctcccctgga aaggacacca tgagcactga aagcatgatc cgggacgtgg       600
     agctggccga ggaggcgctc cccaagaaga caggggggcc ccagggctcc aggcggtgct       660
     tgttcctcag cctcttctcc ttcctgatcg tggcaggcgc caccacgctc ttctgcctgc       720
     tgcactttgg agtgatcggc ccccagaggg aagaggtgag tgcctggcca gccttcatcc       780
     actctcccac ccaaggggaa atggagacgc aagagaggga gagagatggg atgggtgaaa       840
     gatgtgcgct gatagggagg gatggagaga aaaaaacgtg gagaaagacg gggatgcaga       900
     aagagatgtg gcaagagatg gggaagagag agagagaaag atggagagac aggatgtctg       960
     gcacatggaa ggtgctcact aagtgtgtat ggagtgaatg aatgaatgaa tgaatgaaca      1020
     agcagatata taaataagat atggagacag atgtggggtg tgagaagaga gatgggggaa      1080
     gaaacaagtg atatgaataa agatggtgag acagaaagag cgggaaatat gacagctaag      1140
     gagagagatg ggggagataa ggagagaaga agatagggtg tctggcacac agaagacact      1200
     cagggaaaga gctgttgaat gcctggaagg tgaatacaca gatgaatgga gagagaaaac      1260
     cagacacctc agggctaaga gcgcaggcca gacaggcagc cagctgttcc tcctttaagg      1320
     gtgactccct cgatgttaac cattctcctt ctccccaaca gttccccagg gacctctctc      1380
     taatcagccc tctggcccag gcagtcagta agtgtctcca aacctctttc ctaattctgg      1440
     gtttgggttt gggggtaggg ttagtaccgg tatggaagca gtgggggaaa tttaaagttt      1500
     tggtcttggg ggaggatgga tggaggtgaa agtagggggg tattttctag gaagtttaag      1560
     ggtctcagct ttttcttttc tctctcctct tcaggatcat cttctcgaac cccgagtgac      1620
     aagcctgtag cccatgttgt aggtaagagc tctgaggatg tgtcttggaa cttggagggc      1680
     taggatttgg ggattgaagc ccggctgatg gtaggcagaa cttggagaca atgtgagaag      1740
     gactcgctga gctcaaggga agggtggagg aacagcacag gccttagtgg gatactcaga      1800
     acgtcatggc caggtgggat gtgggatgac agacagagag gacaggaacc ggatgtgggg      1860
     tgggcagagc tcgagggcca ggatgtggag agtgaaccga catggccaca ctgactctcc      1920
     tctccctctc tccctccctc cagcaaaccc tcaagctgag gggcagctcc agtggctgaa      1980
     ccgccgggcc aatgccctcc tggccaatgg cgtggagctg agagataacc agctggtggt      2040
     gccatcagag ggcctgtacc tcatctactc ccaggtcctc ttcaagggcc aaggctgccc      2100
     ctccacccat gtgctcctca cccacaccat cagccgcatc gccgtctcct accagaccaa      2160
     ggtcaacctc ctctctgcca tcaagagccc ctgccagagg gagaccccag agggggctga      2220
     ggccaagccc tggtatgagc ccatctatct gggaggggtc ttccagctgg agaagggtga      2280
     ccgactcagc gctgagatca atcggcccga ctatctcgac tttgccgagt ctgggcaggt      2340
     ctactttggg atcattgccc tgtgaggagg acgaacatcc aaccttccca aacgcctccc      2400
     ctgccccaat ccctttatta ccccctcctt cagacaccct caacctcttc tggctcaaaa      2460
     agagaattgg gggcttaggg tcggaaccca agcttagaac tttaagcaac aagaccacca      2520
     cttcgaaacc tgggattcag gaatgtgtgg cctgcacagt gaagtgctgg caaccactaa      2580
     gaattcaaac tggggcctcc agaactcact ggggcctaca gctttgatcc ctgacatctg      2640
     gaatctggag accagggagc ctttggttct ggccagaatg ctgcaggact tgagaagacc      2700
     tcacctagaa attgacacaa gtggacctta ggccttcctc tctccagatg tttccagact      2760
     tccttgagac acggagccca gccctcccca tggagccagc tccctctatt tatgtttgca      2820
     cttgtgatta tttattattt atttattatt tatttattta cagatgaatg tatttatttg      2880
     ggagaccggg gtatcctggg ggacccaatg taggagctgc cttggctcag acatgttttc      2940
     cgtgaaaacg gagctgaaca ataggctgtt cccatgtagc cccctggcct ctgtgccttc      3000
     ttttgattat gttttttaaa atatttatct gattaagttg tctaaacaat gctgatttgg      3060
     tgaccaactg tcactcattg ctgagcctct gctccccagg gga                        3103
//


spacer
spacer