spacer

EBI Dbfetch

ID   M26038; SV 1; linear; mRNA; STD; HUM; 1157 BP.
XX
AC   M26038;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II DR beta mRNA, complete cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1157
RX   DOI; 10.1007/BF00352840.
RX   PUBMED; 2497068.
RA   Jonsson A.K., Andersson L., Rask L.;
RT   "A cellular and functional split in the DRw8 haplotype is due to a single
RT   amino acid replacement (DR beta ser 57- asp 57)";
RL   Immunogenetics 29(5):308-316(1989).
XX
DR   MD5; 286a471de22fc5be97a3b70e6551bb3b.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by A.-K.Jonsson, 07-JUL-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1157
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..1157
FT                   /note="MHC DR beta mRNA"
FT   sig_peptide     47..145
FT                   /gene="HLA-DRB1L"
FT                   /note="MHC DR beta protein signal peptide"
FT   CDS             47..847
FT                   /codon_start=1
FT                   /gene="HLA-DRB1L"
FT                   /note="MHC DR beta protein precursor"
FT                   /db_xref="GOA:Q30134"
FT                   /db_xref="H-InvDB:HIT000195025.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*08:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="AAA59794.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRALV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWSARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     146..844
FT                   /gene="HLA-DRB1L"
FT                   /note="MHC DR beta protein"
XX
SQ   Sequence 1157 BP; 241 A; 308 C; 329 G; 279 T; 0 other;
     cgacttgcct gctgctctgg cccctggtcc tgtcctgttc tccagcatgg tgtgtctgag        60
     gctccctgga ggctcctgca tggcagttct gacagtgaca ctgatggtgc tgagctcccc       120
     actggctttg gctggggaca ccagaccacg tttcttggag tactctacgg gtgagtgtta       180
     tttcttcaat gggacggagc gggtgcggtt cctggacaga tacttctata accaagagga       240
     gtacgtgcgc ttcgacagcg acgtggggga gtaccgggcg gtgacggagc tggggcggcc       300
     tgatgccgag tactggaaca gccagaagga cttcctggaa gacaggcggg ccctggtgga       360
     cacctactgc agacacaact acggggttgg tgagagcttc acggtgcagc ggcgagtcca       420
     tcctaaggtg actgtgtatc cttcaaagac ccagcccctg cagcaccaca acctcctggt       480
     ctgttctgtg agtggtttct atccaggcag cattgaagtc aggtggttcc ggaatggcca       540
     ggaagagaag actggggtgg tgtccacagg cctgatccac aatggagact ggaccttcca       600
     gaccctggtg atgctggaaa cagttcctcg gagtggagag gtttacacct gccaagtgga       660
     gcacccaagc gtgacaagcc ctctcacagt ggaatggagt gcacggtctg aatctgcaca       720
     gagcaagatg ctgagtggag tcgggggctt tgtgctgggc ctgctcttcc ttggggccgg       780
     gctgttcatc tacttcagga atcagaaagg acactctgga cttcagccaa caggattcct       840
     gagctgaagt gcagatgaca atttaaggaa gaatcttctt ccccagcttt gcaggatgaa       900
     aagctttccc gcctggctgt tattcttcca cgagagaggg ctttctcagg acctagttgc       960
     tactggttca gcaactgcag aaaatgtcct cccttgtggc ttcctcagtt cctgcccttg      1020
     gcctgaagtc ccagcgattg atggcagcgc ctcatcttca acttttgtgc tcccctttgc      1080
     ctaaacccta tggcctcctg tgcatctgta ctcaccctgt accacaaaca cattacatta      1140
     ttaaatgttt ctcaaag                                                     1157
//


spacer
spacer