spacer

EBI Dbfetch

ID   M24397; SV 1; linear; mRNA; STD; MUS; 300 BP.
XX
AC   M24397;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse amyloid beta protein 695 (mBPP695) protease inhibitor domain, partial
DE   cds.
XX
KW   amyloid beta protein 695; protease inhibitory activity;
KW   transmembrane protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-300
RX   DOI; 10.1016/0006-291X(89)92808-8.
RX   PUBMED; 2493250.
RA   Yamada T., Sasaki H., Dohura K., Goto I., Sakaki Y.;
RT   "Structure and expression of the alternatively-spliced forms of mRNA for
RT   the mouse homolog of Alzheimer's disease amyloid beta protein precursor";
RL   Biochem. Biophys. Res. Commun. 158(3):906-912(1989).
XX
DR   MD5; 5d9357590b9cf021bfb5c93390a15b49.
DR   Ensembl-Gn; ENSMUSG00000022892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005406; mus_musculus.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by T.Yamada, 26-MAY-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   misc_feature    1..300
FT                   /note="serine protease inhibitory domain"
FT   CDS             <1..>300
FT                   /codon_start=1
FT                   /note="amyloid beta protein 695"
FT                   /db_xref="GOA:P12023"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="PDB:2ROZ"
FT                   /db_xref="PDB:2YSZ"
FT                   /db_xref="PDB:2YT0"
FT                   /db_xref="PDB:2YT1"
FT                   /protein_id="AAA39929.1"
FT                   /translation="ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCG
FT                   GNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLE"
XX
SQ   Sequence 300 BP; 72 A; 83 C; 86 G; 59 T; 0 other;
     gagtccgtgg aggaggtggt ccgagaggtg tgctctgaac aagccgagac cgggccatgc        60
     cgcgcaatga tctcccgctg gtactttgat gtcactgaag ggaagtgtgt cccattcttt       120
     tacggcggat gtggcggcaa caggaacaac tttgacacgg aagagtactg catggcggtg       180
     tgtggcagcg tgtcaaccca aagtttactc aagactacca gtgaacctct tccccaagat       240
     cctgataaac ttcccacgac agcagccagc acccccgacg ccgtcgacaa gtacctggag       300
//


spacer
spacer