spacer

EBI Dbfetch

ID   M23014; SV 1; linear; mRNA; STD; MUS; 183 BP.
XX
AC   M23014; M18751;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mouse transferrin mRNA, partial cds, segment 2.
XX
KW   transferrin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-183
RX   PUBMED; 3693348.
RA   Chen L.-H., Bissell M.J.;
RT   "Transferrin mRNA level in the mouse mammary gland is regulated by
RT   pregnancy and extracellular matrix";
RL   J Biol Chem 262(36):17247-17250(1987).
XX
DR   MD5; 3c9b600c5feb5c4578d717e7d6cd8d72.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..183
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>183
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAA40489.1"
FT                   /translation="GKEDLIWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGL
FT                   LRVPPRMDYRLYLGHN"
XX
SQ   Sequence 183 BP; 50 A; 43 C; 46 G; 44 T; 0 other;
     ggcaaggaag acttgatctg ggagattctc aaagtggcac aggaacactt tggcaaaggc        60
     aaatcaaaag acttccaact gttcagctct cctcttggga aagacctgct gtttaaagat       120
     tctgcctttg ggctgttaag ggtcccccca aggatggact acaggctgta ccttggccat       180
     aac                                                                     183
//


spacer
spacer