Dbfetch

ID   AH002107; SV 2; linear; mRNA; STD; MUS; 935 BP.
XX
AC   AH002107; M18751; M23013-M23016;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Mus musculus transferrin mRNAs, partial cds.
XX
KW   transferrin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-935
RX   PUBMED; 3693348.
RA   Chen L.H., Bissell M.J.;
RT   "Transferrin mRNA level in the mouse mammary gland is regulated by
RT   pregnancy and extracellular matrix";
RL   J Biol Chem 262(36):17247-17250(1987).
XX
DR   MD5; 50561a2a164b7a4811e516cad24a5222.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:202170,
CC   gi:202171, gi:202172, gi:202173, gi:202174.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..935
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>197
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /protein_id="AAA40488.1"
FT                   /translation="DCIRAIAASEADAMTLDGGLVYDAGLTPNNLKPVAAEFCGSVEHP
FT                   QTSYYAVAVVKKERDFQLNQL"
FT   gap             198..297
FT                   /estimated_length=unknown
FT   CDS             <298..>480
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /protein_id="AAA40489.1"
FT                   /translation="GKEDLIWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGL
FT                   LRVPPRMDYRLYLGHN"
FT   gap             481..580
FT                   /estimated_length=unknown
FT   CDS             <581..>685
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /protein_id="AAA40490.1"
FT                   /translation="TWNNLKGKKSCHTGVDRTAGWNIPMCMLYNRINHC"
FT   gap             686..785
FT                   /estimated_length=unknown
FT   CDS             <786..>935
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /protein_id="AAA40491.1"
FT                   /translation="CDPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEW
FT                   AKNLN"
XX
SQ   Sequence 935 BP; 177 A; 148 C; 174 G; 136 T; 300 other;
     gattgcatca gggccattgc tgcaagtgaa gccgatgcta tgaccttgga tggggggttg        60
     gtgtacgatg ccggcctgac tccgaacaac ctgaagcccg tggcggcgga gttttgtgga       120
     tcagtggaac atccacagac ctcctactac gctgtggctg tggtaaagaa ggaacgagac       180
     ttccagctga accagctnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnggc       300
     aaggaagact tgatctggga gattctcaaa gtggcacagg aacactttgg caaaggcaaa       360
     tcaaaagact tccaactgtt cagctctcct cttgggaaag acctgctgtt taaagattct       420
     gcctttgggc tgttaagggt ccccccaagg atggactaca ggctgtacct tggccataac       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn acctggaaca acctgaaagg       600
     caagaagtcc tgccacactg gggtagacag aaccgctggt tggaacatcc ctatgtgcat       660
     gctgtacaac aggatcaacc actgcnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnntgtga tccgaacaac aaagaggaat ataatggtta cacaggggct ttcaggtgtc       840
     tcgttgagaa aggagatgta gcctttgtga aacaccagac tgtcctggat aacaccgaag       900
     gaaagaaccc tgccgaatgg gctaagaatc tgaat                                  935
//