spacer

EBI Dbfetch

ID   M23013; SV 1; linear; mRNA; STD; MUS; 197 BP.
XX
AC   M23013; M18751;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mouse transferrin mRNA, partial cds, segment 1.
XX
KW   transferrin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-197
RX   PUBMED; 3693348.
RA   Chen L.-H., Bissell M.J.;
RT   "Transferrin mRNA level in the mouse mammary gland is regulated by
RT   pregnancy and extracellular matrix";
RL   J Biol Chem 262(36):17247-17250(1987).
XX
DR   MD5; f740228f93f27771aebf65b9951f3075.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..197
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>197
FT                   /codon_start=1
FT                   /note="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAA40488.1"
FT                   /translation="DCIRAIAASEADAMTLDGGLVYDAGLTPNNLKPVAAEFCGSVEHP
FT                   QTSYYAVAVVKKERDFQLNQL"
XX
SQ   Sequence 197 BP; 45 A; 48 C; 62 G; 42 T; 0 other;
     gattgcatca gggccattgc tgcaagtgaa gccgatgcta tgaccttgga tggggggttg        60
     gtgtacgatg ccggcctgac tccgaacaac ctgaagcccg tggcggcgga gttttgtgga       120
     tcagtggaac atccacagac ctcctactac gctgtggctg tggtaaagaa ggaacgagac       180
     ttccagctga accagct                                                      197
//


spacer
spacer