spacer

EBI Dbfetch

ID   M22550; SV 1; linear; mRNA; STD; HUM; 282 BP.
XX
AC   M22550;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DQ beta mRNA (DR3,DQw), partial cds, clone 2041C72.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   PUBMED; 2892884.
RA   Hurley C.K., Gregersen P., Steiner N., Bell J., Hartzman R., Nepom G.,
RA   Silver J., Johnson A.H.;
RT   "Polymorphism of the HLA-D region in American blacks. A DR3 haplotype
RT   generated by recombination";
RL   J. Immunol. 140(3):885-892(1988).
XX
DR   MD5; 3bd2c0c02343072e112a3116e9c95d61.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000374943; homo_sapiens.
DR   Ensembl-Tr; ENST00000399079; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
DR   Ensembl-Tr; ENST00000484729; homo_sapiens.
XX
CC   Draft entry and printed copy of sequence for [1] kindly provided by
CC   C.Hurley, 30-NOV-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB3"
FT                   /note="MHC class II HLA-DQ beta glycoprotein"
FT                   /db_xref="GOA:O19741"
FT                   /db_xref="H-InvDB:HIT000194849.9"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19741"
FT                   /protein_id="AAA59821.1"
FT                   /translation="RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVG
FT                   VYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRR"
XX
SQ   Sequence 282 BP; 61 A; 70 C; 102 G; 49 T; 0 other;
     agagactctc ccgaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg        60
     acggagcgcg tgcgtcttgt gaccagatac atctataacc gagaggagta cgcgcgcttc       120
     gacagcgacg tgggggtgta ccgcgcggtg acgccgcagg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggaagt cctggagggg acccgggcgg agttggacac ggtgtgcaga       240
     cacaactacg aggtggcgtt ccgcgggatc ttgcagagga ga                          282
//


spacer
spacer