spacer

EBI Dbfetch

ID   M22115; SV 1; linear; mRNA; STD; MUS; 2216 BP.
XX
AC   M22115;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mouse ERA-1-993 mRNA, complete cds, and alternate ERA-1-339 mRNA, complete
DE   cds.
XX
KW   early retinoic acid protein; ERA-1 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2216
RX   PUBMED; 2906112.
RA   LaRosa G.J., Gudas L.J.;
RT   "Early retinoic acid-induced F9 teratocarcinoma stem cell gene ERA-1:
RT   alternate splicing creates transcripts for a homeobox-containing protein
RT   and one lacking the homeobox";
RL   Mol. Cell. Biol. 8(9):3906-3917(1988).
XX
DR   MD5; e96901151835b641e0ccea7c0fa14c8a.
DR   Ensembl-Gn; ENSMUSG00000029844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000964; mus_musculus.
DR   EuropePMC; PMC2613157; 18959802.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2216
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             81..1076
FT                   /codon_start=1
FT                   /note="ERA-1-993 protein"
FT                   /db_xref="GOA:P09022"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09022"
FT                   /protein_id="AAA37559.1"
FT                   /translation="MNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSANSCGGD
FT                   DRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPY
FT                   GPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQE
FT                   QQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYV
FT                   GQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQK
FT                   KREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH"
FT   exon            <81..422
FT                   /note="ERA-1-399 protein"
FT   CDS             join(81..422,626..685)
FT                   /partial
FT                   /codon_start=1
FT                   /note="ERA-1-399 protein"
FT                   /db_xref="GOA:P09022"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09022"
FT                   /protein_id="AAA37558.1"
FT                   /translation="MNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSANSCGGD
FT                   DRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPY
FT                   GPYGLNQEADPPRSLSFPCFRDVFSSADL"
FT   exon            626..>685
FT                   /note="ERA-1-399 protein"
FT   misc_feature    753..932
FT                   /note="ERA-1-993 protein homeobox"
XX
SQ   Sequence 2216 BP; 541 A; 610 C; 486 G; 579 T; 0 other;
     tggaggaagt gagaaagttg gcacggtcac ccagggcttc gcaggatcca atcactcagt        60
     gacagatgga caatgcaaga atgaactcct ttctggaata ccccatcctt ggcagtggcg       120
     actctgggac ctgctcggcg cgagcttacc cctctgacca tgggattaca actttccaat       180
     cctgcgcggt cagtgccaac agctgcggcg gcgacgaccg cttcctagtg ggcagggggg       240
     tgcagatcag ctcgccccac caccaccacc accaccacca ccatcaccac ccccagacgg       300
     ctacttacca gacttctgga aaccttggga tttcttattc ccactcgagt tgtggtccaa       360
     gctatggcgc gcagaacttc agtgcgcctt atggccccta tggattaaat caggaagcag       420
     acgtaagtgg tgggtacccc ccgtgcgctc ccgctgttta ctctggaaac ctctcgactc       480
     ccatggtcca gcatcaccac caccaccagg gttatgctgg gggcacagtg ggctcgcccc       540
     agtacattca ccactcatat ggacaagagc agcagactct ggccctggcc acgtataata       600
     actccttatc ccctctccac gccagccacc aagaagcctg tcgttcccct gcttcagaga       660
     cgtcttctcc agcgcagacc tttgactgga tgaaagttaa aagaaaccct cccaaaacag       720
     ggaaagttgg agagtacggc tacgtgggtc aacccaacgc agtgcgcacc aatttcacca       780
     ccaagcagct cacagagctg gagaaggagt tccacttcaa caagtacctt acacgagcgc       840
     gcagggtgga gattgccgcg tccctacagc tcaatgagac ccaggtgaag atctggttcc       900
     agaatcgccg catgaagcag aagaagcgtg agaaggaggg gctcctgccc atctcccctg       960
     ccactcctcc tggcagcgat gagaaaacgg aagaatcatc tgagaaatct agcccctcgc      1020
     ccagtgcccc ttctccggca tcgtctacct cagacactct gactacctcc cactgaggct      1080
     actccagccc aactctgcag cccaggcttc tccctgggct gggatttctt acccaaagca      1140
     cattcttagc ttatcttcct ttctttacag actctctctt cctttctcgt cccatctggg      1200
     gagctcctgg ccaagataag gtatttccag gagaattctg gagccttggt tggaagttaa      1260
     ctccttcatc cacatcgggt gtccacatca attgctgatg gctcccaaca tcctttcctt      1320
     cactgttgtg agattttttt ctccccacaa cctatgattc cttttagatg tcggctggag      1380
     aacagttagt tccctttgcc atcagacatt tgcaggaagg aggcatctct ccttttatct      1440
     atgtattgtt cttctccacc tagcccttaa gtaggacata gaggagagag agtgtccaaa      1500
     gactcatgaa gaagagatgc actgtgttta cacaattaat tcacccccta acttagctgg      1560
     tttcatgtgt gtgagtttgc tggttgtaaa tgctttcccg tcagagattt atctttatac      1620
     acattttata gaaatatgta ggtcactaaa tcaaacaggg tggacaaatt ctcaaaactg      1680
     gtacagttca tgtgtgatta tgggcgaaag aagaaaacct ctttcattca aacagagtca      1740
     gatgcctcag aagttggcct caattggttc tttcagagtt aagaaggcct gcgaagcact      1800
     ttgcctgtgc caggtcttcc caaactctaa ccaattcttc ctgcttctct ggccaccgtg      1860
     catttaaaaa tcatgctgga tcatttgtaa cccaaaggta ttcattcttt cagtcaccct      1920
     ttccttccac actgtcttgt atcatggctg gatccagtgt attccagcta attgttaatg      1980
     tgatggatgg cacaatgaat gtatattttg tgtgattcgt gactagtctt ctgcatgtcg      2040
     cacaatgttc tgatgtccct gaaatatcac actgagttct atcagttatt ctttgtgagc      2100
     ctatgatagt ctccatttac tgtacaatca tgaacagctc tgagatcctg gagtgatgtg      2160
     gtccagagca gagtttacgg gtcttaacat gtctgtaata aaagtattca agtttt          2216
//


spacer
spacer