spacer

EBI Dbfetch

ID   M22050; SV 1; linear; genomic DNA; STD; HUM; 353 BP.
XX
AC   M22050;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   Human MHC class II HLA-DRw11-beta-I chain (DRw11.3) gene (DRw11/w11), exon
DE   5.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-353
RX   DOI; 10.1007/BF00375861.
RX   PUBMED; 3137159.
RA   Steimle V., Hinkkanen A., Schlesier M., Epplen J.T.;
RT   "A novel HLA-DR beta I sequence from the DRw11 haplotype";
RL   Immunogenetics 28(3):208-210(1988).
XX
DR   MD5; 85577d2325c084a341ca5768b3e5a9d1.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
CC   Draft entry and clean copy of sequence for [1] kindly provided by
CC   T.Epplen, 03-JAN-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..353
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="Patient UA-S2"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRw11/w11"
FT                   /db_xref="taxon:9606"
FT   CDS             join(M21966.1:41..140,M22047.1:3..272,M22048.1:3..283,
FT                   M22049.1:3..115,1..37)
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="precursor"
FT                   /db_xref="GOA:P20039"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*11:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20039"
FT                   /protein_id="AAA59713.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDERAAV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   mat_peptide     join(M21966.1:128..140,M22047.1:3..272,M22048.1:3..283,
FT                   M22049.1:3..115,1..34)
FT                   /gene="HLA-DRB1"
FT                   /note="G00-120-642"
FT   exon            1..353
FT                   /gene="HLA-DRB1"
FT                   /number=5
FT                   /note="G00-120-642"
XX
SQ   Sequence 353 BP; 81 A; 101 C; 71 G; 100 T; 0 other;
     acactctgga cttcagccaa gaggattcct gagctgaagt gcagatgaca cattcaaaga        60
     agaacttctg ccccaggttt gcaggatgaa aagctttccc tcctggctgt tattcttcca       120
     caagagaggg ctttctcagg acctggttgc tactggttca gcaactgcag aaaatgtcct       180
     cccttgtggc ttcctcagct cctgttcttg gcctgaagcc ccacaggctt tgatggcagc       240
     gcctcatctt caacttttgt gctccccttt gcctaaaccc tatggcctcc tgtgcatctg       300
     tactcaccct gtaccacaaa cacattacat tattaaatgt ttctcaaaga tgg              353
//


spacer
spacer