Dbfetch

ID   AH002884; SV 2; linear; genomic DNA; STD; HUM; 1569 BP.
XX
AC   AH002884; M21966; M22047-M22050;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens isolate Patient UA-S2 precursor (HLA-DRB1) gene, complete cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1569
RX   DOI; 10.1007/BF00375861.
RX   PUBMED; 3137159.
RA   Steimle V., Hinkkanen A., Schlesier M., Epplen J.T.;
RT   "A novel HLA-DR beta I sequence from the DRw11 haplotype";
RL   Immunogenetics 28(3):208-210(1988).
XX
DR   MD5; 0a5d0b97d9c253ae6cf72ba8980cb9ce.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:187970,
CC   gi:187971, gi:187972, gi:187973, gi:187974, gi:187975.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1569
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="Patient UA-S2"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRw11/w11"
FT                   /db_xref="taxon:9606"
FT   gene            1..1569
FT                   /gene="HLA-DRB1"
FT   exon            <1..140
FT                   /gene="HLA-DRB1"
FT                   /number=1
FT                   /note="G00-120-642"
FT   CDS             join(41..140,243..512,617..897,1002..1114,1217..1253)
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="precursor"
FT                   /protein_id="AAA59713.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDERAAV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   sig_peptide     41..127
FT                   /gene="HLA-DRB1"
FT                   /note="G00-120-642"
FT   mat_peptide     join(128..140,243..512,617..897,1002..1114,1217..1250)
FT                   /gene="HLA-DRB1"
FT                   /product="G00-120-642"
FT   gap             141..240
FT                   /estimated_length=unknown
FT   intron          <241..242
FT                   /gene="HLA-DRB1"
FT                   /number=1
FT                   /note="G00-120-642"
FT   exon            243..512
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="G00-120-642"
FT   intron          513..>514
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="G00-120-642"
FT   gap             515..614
FT                   /estimated_length=unknown
FT   intron          <615..616
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="G00-120-642"
FT   exon            617..897
FT                   /gene="HLA-DRB1"
FT                   /number=3
FT                   /note="G00-120-642"
FT   intron          898..>899
FT                   /gene="HLA-DRB1"
FT                   /number=3
FT                   /note="G00-120-642; putative; does not fit consensus"
FT   gap             900..999
FT                   /estimated_length=unknown
FT   intron          <1000..1001
FT                   /gene="HLA-DRB1"
FT                   /number=3
FT                   /note="G00-120-642; putative; does not fit consensus"
FT   exon            1002..1114
FT                   /gene="HLA-DRB1"
FT                   /number=4
FT                   /note="G00-120-642"
FT   intron          1115..>1116
FT                   /gene="HLA-DRB1"
FT                   /number=4
FT                   /note="G00-120-642; putative; does not fit consensus"
FT   gap             1117..1216
FT                   /estimated_length=unknown
FT   exon            1217..1569
FT                   /gene="HLA-DRB1"
FT                   /number=5
FT                   /note="G00-120-642"
XX
SQ   Sequence 1569 BP; 246 A; 308 C; 335 G; 280 T; 400 other;
     gcctgctgct ctggcccctg gtcctgtcct gttctccagc atggtgtgtc tgaggctccc        60
     tggaggctcc tgcatggcag ttctgacagt gacactgatg gtgctgagct ccccactggc       120
     tttggctggg gacaccagac nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     agcacgtttc ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt       300
     gcggttcctg gacagatact tctataacca agaggagtac gtgcgcttcg acagcgacgt       360
     gggggagttc cgggcggtga cggagctggg gcggcctgat gaggagtact ggaacagcca       420
     gaaggacttc ctggaagacg agcgggccgc ggtggacacc tactgcagac acaactacgg       480
     ggttgtggag agcttcacag tgcagcggcg aggtnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnagtcca tcctaaggtg actgtgtatc cttcaaagac ccagcccctg       660
     cagcaccaca acctcctggt ctgttctgtg agtggtttct atccaggcag cattgaagtc       720
     aggtggttcc ggaatggcca ggaagagaag actggggtgg tgtccacagg cctgatccac       780
     aatggagact ggaccttcca gaccctggtg atgctggaaa cagttcctcg gagtggagag       840
     gtttacacct gccaagtgga gcacccaagc gtgacaagcc ctctcacagt ggaatggtgn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt cagagcacgg tctgaatctg      1020
     cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc ttccttgggg      1080
     ccgggctgtt catctacttc aggaatcaga aaggtgnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnacac tctggacttc agccaagagg attcctgagc tgaagtgcag      1260
     atgacacatt caaagaagaa cttctgcccc aggtttgcag gatgaaaagc tttccctcct      1320
     ggctgttatt cttccacaag agagggcttt ctcaggacct ggttgctact ggttcagcaa      1380
     ctgcagaaaa tgtcctccct tgtggcttcc tcagctcctg ttcttggcct gaagccccac      1440
     aggctttgat ggcagcgcct catcttcaac ttttgtgctc ccctttgcct aaaccctatg      1500
     gcctcctgtg catctgtact caccctgtac cacaaacaca ttacattatt aaatgtttct      1560
     caaagatgg                                                              1569
//