spacer

EBI Dbfetch

ID   M21008; SV 1; linear; mRNA; STD; HUM; 694 BP.
XX
AC   M21008;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA-DR1 beta mRNA (DR1,DQw1,Dw), 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-694
RX   PUBMED; 2453563.
RA   Hurley C.K., Ziff B.L., Silver J., Gregersen P.K., Hartzman R.,
RA   Johnson A.H.;
RT   "Polymorphism of the HLA-DR1 haplotype in American blacks. Identification
RT   of a DR1 beta-chain determinant recognized in the mixed lymphocyte
RT   reaction";
RL   J. Immunol. 140(11):4019-4023(1988).
XX
DR   MD5; d423ebba37f411dca5568b288aaa0395.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   Draft entry and printed copy of sequence for [1] kindly provided by
CC   C.Hurley, 30-NOV-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..694
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..694
FT                   /gene="HLA-DRB1"
FT   CDS             <1..694
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR1-beta"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="H-InvDB:HIT000194766_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="AAA59780.1"
FT                   /translation="LWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTE
FT                   LGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGAVESFTVQRRVEPKVTVYPSKTQPLQH
FT                   HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEV
FT                   YTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNEKGHSG
FT                   LQPTGFLS"
XX
SQ   Sequence 694 BP; 153 A; 168 C; 231 G; 142 T; 0 other;
     cttgtggcag cttaagtttg aatgtcattt cttcaatggg acggagcggg tgcggttgct        60
     ggaaagatgc atctataacc aagaggagtc cgtgcgcttc gacagcgacg tgggggagta       120
     ccgggcggtg acggagctgg ggcggcctga tgccgagtac tggaacagcc agaaggacct       180
     cctggagcag aggcgggccg cggtggacac ctattgcaga cacaactacg gggctgtgga       240
     gagcttcaca gtgcagcggc gagttgagcc taaggtgact gtgtatcctt caaagaccca       300
     gcccctgcag caccacaacc tcctggtctg ctctgtgagt ggtttctatc caggcagcat       360
     tgaagtcagg tggttccgga acggccagga agagaaggct ggggtggtgt ccacaggcct       420
     gatccagaat ggagattgga ccttccagac cctggtgatg ctggaaacag ttcctcggag       480
     tggagaggtt tacacctgcc aagtggagca cccaagtgtg acgagccctc tcacagtgga       540
     atggagagca cggtctgaat ctgcacagag caagatgctg agtggagtcg ggggcttcgt       600
     gctgggcctg ctcttccttg gggccgggct gttcatctac ttcaggaatg agaaaggaca       660
     ctctggactt cagccaacag gattcctgag ctga                                   694
//


spacer
spacer