spacer

EBI Dbfetch

ID   M20504; SV 1; linear; mRNA; STD; HUM; 1039 BP.
XX
AC   M20504;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II HLA DR-beta-2 mRNA, complete cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1039
RX   PUBMED; 3129499.
RA   Liu C.P., Bach F.H., Wu S.K.;
RT   "Molecular studies of a rare DR2/LD-5a/DQw3 HLA class II haplotype.
RT   Multiple genetic mechanisms in the generation of polymorphic HLA class II
RT   genes";
RL   J. Immunol. 140(10):3631-3639(1988).
XX
DR   MD5; a99ef4886340a4990314954fe3efe7a8.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1039
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     36..122
FT                   /gene="HLA-DRB2"
FT                   /note="MHC HLA-DR-beta-2 signal peptide; G00-120-643"
FT   CDS             36..836
FT                   /codon_start=1
FT                   /gene="HLA-DRB2"
FT                   /note="MHC HLA-DR-beta-2 precursor"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="H-InvDB:HIT000194734.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAA59827.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   gene            36..836
FT                   /gene="HLA-DRB2"
FT   mat_peptide     123..833
FT                   /gene="HLA-DRB2"
FT                   /note="MHC HLA-DR-beta-2; G00-120-643"
XX
SQ   Sequence 1039 BP; 219 A; 279 C; 313 G; 228 T; 0 other;
     cttctctggc ccctggtcct gtcctgttct ccagcatggt gtgtctgaag ctccctggag        60
     gctcctgcat gacagcgctg acagtgacac tgatggtgct gagctcccca ctggctttgg       120
     ctggggacac ccgaccacgt ttcctgtggc agcctaagag ggagtgtcat ttcttcaatg       180
     ggacggagcg ggtgcggttc ctggacagat acttctataa ccaggaggag tccgtgcgct       240
     tcgacagcga cgtgggggag taccgggcgg tgacggagct ggggcggcct gacgctgagt       300
     actggaacag ccagaaggac ctcctggaag acaggcgcgc cgcggtggac acctactgca       360
     gacacaacta cggggttggt gagagcttca cagtgcagcg gcgagtccaa cctaaggtga       420
     ctgtatatcc ttcaaagacc cagcccctgc agcaccacaa cctcctggtc tgctctgtga       480
     gtggtttcta tccaggcagc attgaagtca ggtggttcct gaacggccag gaagagaagg       540
     ctgggatggt gtccacaggc ctgatccaga atggagactg gaccttccag accctggtga       600
     tgctggaaac agttcctcga agtggagagg tttacacctg ccaagtggag cacccaagcg       660
     tgacaagccc tctcacagtg gaatggagag cacggtctga atctgcacag agcaagatgc       720
     tgagtggagt cgggggcttt gtgctgggcc tgctcttcct tggggccggg ctgttcatct       780
     acttcaggaa tcagaaagga cactctggac ttcagccaac aggattcctg agctgaaatg       840
     cagatgacca cattcaagga agaactttct gccccggctt tgcaggatga aaagctttcc       900
     tgcttggcag ttattcttcc acaagagagg gctttctcag gacctggttg ctactggttc       960
     ggcaactgca gaaaatgtcc tcccttgtgg cttcctcagc tcctgccctt ggcctgaagt      1020
     cccagcattg atggcagcg                                                   1039
//


spacer
spacer