spacer

EBI Dbfetch

ID   M20216; SV 1; linear; genomic DNA; STD; MUS; 527 BP.
XX
AC   M20216; M15926;
XX
DT   29-JUL-1991 (Rel. 28, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus Hox1.6 protein (Hox1.6) gene, exon 4 and complete cds.
XX
KW   homeo box.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-527
RX   PUBMED; 2891503.
RA   Baron A., Featherstone M.S., Hill R.E., Hall A., Galliot B., Duboule D.;
RT   "Hox-1.6: a mouse homeo-box-containing gene member of the Hox-1 complex";
RL   EMBO J. 6(10):2977-2986(1987).
XX
DR   MD5; a709255683afee2600c32fb0ebfdff48.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..527
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="embryo"
FT                   /clone_lib="library of H.Lehrach"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(M20214.1:<20..435,M20215.1:15..109,16..>371)
FT                   /gene="Hox1.6"
FT                   /product="Hox1.6 protein"
FT   CDS             join(M20215.1:79..109,16..371)
FT                   /codon_start=1
FT                   /gene="Hox1.6"
FT                   /product="Hox1.6 protein"
FT                   /db_xref="GOA:P09022"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09022"
FT                   /protein_id="AAA37839.1"
FT                   /translation="MKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNK
FT                   YLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESS
FT                   EKSSPSPSAPSPASSTSDTLTTSH"
FT   exon            16..527
FT                   /gene="Hox1.6"
FT                   /number=4
FT   misc_feature    48..231
FT                   /gene="Hox1.6"
FT                   /note="encodes homeobox"
XX
SQ   Sequence 527 BP; 125 A; 166 C; 124 G; 112 T; 0 other;
     cctcgggtac gctagggaaa gttggagagt acggctacgt gggtcaaccc aacgcagtgc        60
     gcaccaattt caccaccaag cagctcacag agctggagaa ggagttccac ttcaacaagt       120
     accttacacg agcgcgcagg gtggagattg ccgcgtccct acagctcaat gagacccagg       180
     tgaagatctg gttccagaat cgccgcatga agcagaagaa gcgtgagaag gaggggctcc       240
     tgcccatctc ccctgccact cctcctggca gcgatgagaa aacggaagaa tcatctgaga       300
     aatctagccc ctcgcccagt gccccttctc cggcatcgtc tacctcagac actctgacta       360
     cctcccactg aggctactcc agcccaactc tgcagcccag gcttctccct gggctgggat       420
     ttcttaccca aagcacattc ttagcttatc tcctttcttt acagatctct cttcctttct       480
     cgtcccatct ggggagctcc tggccaagat aaggtatttc cagagaa                     527
//


spacer
spacer