Dbfetch

ID   AH001916; SV 2; linear; genomic DNA; STD; MUS; 1288 BP.
XX
AC   AH001916; M15928; M20214-M20216;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus Hox1.6 protein (Hox1.6) gene, complete cds.
XX
KW   homeo box.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1288
RX   PUBMED; 2891503.
RA   Baron A., Featherstone M.S., Hill R.E., Hall A., Galliot B., Duboule D.;
RT   "Hox-1.6: a mouse homeo-box-containing gene member of the Hox-1 complex";
RL   EMBO J. 6(10):2977-2986(1987).
XX
DR   MD5; 77d7dab6e0f8d992769bac1752662adf.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:193918,
CC   gi:193919, gi:193920, gi:193921.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1288
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="embryo"
FT                   /clone_lib="library of H.Lehrach"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>1288
FT                   /gene="Hox1.6"
FT   mRNA            join(<20..435,558..652,777..>1132)
FT                   /gene="Hox1.6"
FT                   /product="Hox1.6 protein"
FT   exon            20..435
FT                   /gene="Hox1.6"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            558..652
FT                   /gene="Hox1.6"
FT                   /number=3
FT   CDS             join(622..652,777..1132)
FT                   /codon_start=1
FT                   /gene="Hox1.6"
FT                   /product="Hox1.6 protein"
FT                   /protein_id="AAA37839.1"
FT                   /translation="MKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNK
FT                   YLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESS
FT                   EKSSPSPSAPSPASSTSDTLTTSH"
FT   gap             662..761
FT                   /estimated_length=unknown
FT   exon            777..1288
FT                   /gene="Hox1.6"
FT                   /number=4
FT   misc_feature    809..992
FT                   /gene="Hox1.6"
FT                   /note="encodes homeobox"
XX
SQ   Sequence 1288 BP; 258 A; 340 C; 264 G; 226 T; 200 other;
     cttctctggt cctatggagg aagtgagaaa gttggcacgg tcacccatgc ttcgcaggat        60
     ccaatcactc agtgacagat ggacaatgca agaatgaact cctttctgga ataccccatc       120
     cttggcagtg gcgactctgg gacctgctcg gcgcgagctt acccctctga ccatgggatt       180
     acaactttcc aatcctgcgc ggtcagtgcc aacagctgcg gcggcgacga ccgcttccta       240
     gtgggcaggg gggtgcagat cagctcgccc caccaccacc accaccacca ccaccatcac       300
     cacccccaga cggctactta ccagacttct ggaaaccttg ggatttctta ttcccactcg       360
     agttgtggtc caagctatgg cgcgcagaac ttcagtgcgc cttatggccc ctatggatta       420
     aatcaggaag cagacgtaag tggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnncctctcc aggggagcca ccaagaagcc tgtcgttccc ctgcttcaga gacgtcttct       600
     ccagcgcaga cctttgactg gatgaaagtt aaaagaaacc ctcccaaaac agggaaggcg       660
     gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ncctcgggta cgctagggaa       780
     agttggagag tacggctacg tgggtcaacc caacgcagtg cgcaccaatt tcaccaccaa       840
     gcagctcaca gagctggaga aggagttcca cttcaacaag taccttacac gagcgcgcag       900
     ggtggagatt gccgcgtccc tacagctcaa tgagacccag gtgaagatct ggttccagaa       960
     tcgccgcatg aagcagaaga agcgtgagaa ggaggggctc ctgcccatct cccctgccac      1020
     tcctcctggc agcgatgaga aaacggaaga atcatctgag aaatctagcc cctcgcccag      1080
     tgccccttct ccggcatcgt ctacctcaga cactctgact acctcccact gaggctactc      1140
     cagcccaact ctgcagccca ggcttctccc tgggctggga tttcttaccc aaagcacatt      1200
     cttagcttat ctcctttctt tacagatctc tcttcctttc tcgtcccatc tggggagctc      1260
     ctggccaaga taaggtattt ccagagaa                                         1288
//