spacer

EBI Dbfetch

ID   M17378; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M17378;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR2), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; aea9d1337f8f48865c506565e698f360.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /gene="HLA-DRB2"
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:P01911"
FT                   /db_xref="H-InvDB:HIT000194528_02.2"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01911"
FT                   /protein_id="AAA59801.1"
FT                   /translation="GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVG
FT                   EFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPS
FT                   KTQPLQHHNLLVCSVSGFYPASIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLET
FT                   VPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPTGFLS"
XX
SQ   Sequence 714 BP; 159 A; 184 C; 230 G; 141 T; 0 other;
     ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aggaggagtc cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccaacc taaggtgact       300
     gtatatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg ctctgtgagt       360
     ggtttctatc cagccagcat tgaagtcagg tggttcctga acggccagga agagaaggct       420
     gggatggtgt ccacaggcct gatccagaat ggagactgga ccttccagac cctggtgatg       480
     ctggaaacag ttcctcgaag tggagaggtt tacacctgcc aagtggagca cccaagcgtg       540
     acaagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggct gttcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag ctga             714
//


spacer
spacer