spacer

EBI Dbfetch

ID   M16959; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M16959;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA-DR2 (non-Dw2/non-Dw12) b-associated glycoprotein
DE   beta-chain mRNA, 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.13.4591.
RX   PUBMED; 2885840.
RA   Lee B.S.M., Rust N.A., McMichael A.J., McDevitt H.O.;
RT   "HLA-DR2 subtypes form an additional supertypic family of DR beta alleles";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(13):4591-4595(1987).
XX
DR   MD5; 01ec1b8acedf8e9f80c685b67b540217.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /note="MHC HLA-DR2 (non-Dw2/non-Dw12)b glycoprotein
FT                   beta-chain"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="H-InvDB:HIT000194500_02.2"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAA36281.1"
FT                   /translation="GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPS
FT                   KTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLET
FT                   VPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPTGFLS"
XX
SQ   Sequence 714 BP; 160 A; 182 C; 230 G; 142 T; 0 other;
     ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aggaggagtc cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggactt cctggaagac aggcgcgccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc gagtccaacc taaggtgact       300
     gtatatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg ctctgtgagt       360
     ggtttctatc caggcagcat tgaagtcagg tggttcctga acggccagga agagaaggct       420
     gggatggtgt ccacaggcct gatccagaat ggagactgga ccttccagac cctggtgatg       480
     ctggaaacag ttcctcggag tggagaggtt tacacctgcc aagtggagca cccaagtgtg       540
     acgagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggct attcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag ctga             714
//


spacer
spacer