Dbfetch

ID   M16441; SV 1; linear; genomic DNA; STD; HUM; 7112 BP.
XX
AC   M16441;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Human tumor necrosis factor and lymphotoxin genes, complete cds.
XX
KW   lymphotoxin; tumor necrosis factor.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7112
RX   PUBMED; 3555974.
RA   Nedospasov S.A., Shakhov A.N., Turetskaya R.L., Mett V.A., Azizov M.M.,
RA   Georgiev G.P., Korobko V.G., Dobrynin V.N., Filippov S.A., Bystrov N.S.,
RA   Boldyreva E.F., Chuvpilo S.A., Chumakov A.M., Shingarova L.N.,
RA   Ovchinnikov Y.A.;
RT   "Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha)
RT   and lymphotoxin (TNF-beta) in the human genome";
RL   Cold Spring Harb. Symp. Quant. Biol. 51:0-0(0).
XX
DR   MD5; 3cd680f0b5b82b2cff55bad69cfd0b57.
DR   EPD; EP11158; HS_TNF.
DR   EPD; EP11159; HS_LTA.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226979; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230279; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231408; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000412851; homo_sapiens.
DR   Ensembl-Tr; ENST00000418386; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000426845; homo_sapiens.
DR   Ensembl-Tr; ENST00000436519; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   Ensembl-Tr; ENST00000454550; homo_sapiens.
DR   Ensembl-Tr; ENST00000454783; homo_sapiens.
DR   EuropePMC; PMC16559; 10840051.
DR   EuropePMC; PMC167209; 12885910.
DR   EuropePMC; PMC1683171; 1897522.
DR   EuropePMC; PMC2516580; 18709160.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by C.V.Jongeneel, 02-OCT-1988.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7112
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   prim_transcript 819..2855
FT                   /note="lymphotoxin mRNA and introns"
FT   intron          980..1266
FT                   /note="lymphotoxin intron A"
FT   gene            1276..1374
FT                   /gene="TNFB"
FT   CDS             join(1276..1374,1461..1566,1814..2226)
FT                   /codon_start=1
FT                   /note="lymphotoxin"
FT                   /db_xref="GOA:P01374"
FT                   /db_xref="HGNC:HGNC:6709"
FT                   /db_xref="InterPro:IPR002960"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1TNR"
FT                   /db_xref="PDB:4MXV"
FT                   /db_xref="PDB:4MXW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01374"
FT                   /protein_id="AAA61199.1"
FT                   /translation="MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAA
FT                   QTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTS
FT                   GIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPW
FT                   LHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL"
FT   exon            <1276..1374
FT                   /gene="TNFB"
FT                   /number=2
FT                   /note="lymphotoxin,  (first expressed exon); G00-120-442"
FT   intron          1375..1460
FT                   /note="lymphotoxin intron B"
FT   exon            1461..1566
FT                   /number=3
FT   intron          1567..1813
FT                   /note="lymphotoxin intron C"
FT   exon            1814..>2226
FT                   /number=4
FT                   /note="lymphotoxin"
FT   prim_transcript 4095..6859
FT                   /note="TNF mRNA and introns"
FT   exon            <4275..4460
FT                   /gene="TNFA"
FT                   /number=1
FT                   /note="tumor necrosis factor; G00-120-441"
FT   gene            4275..4460
FT                   /gene="TNFA"
FT   CDS             join(4275..4460,5067..5112,5300..5347,5649..6070)
FT                   /codon_start=1
FT                   /note="tumor necrosis factor"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:4Y6O"
FT                   /db_xref="PDB:5MU8"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAA61200.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   intron          4461..5066
FT                   /note="TNF intron A"
FT   exon            5067..5112
FT   intron          5113..5299
FT                   /note="TNF intron B"
FT   exon            5300..5347
FT                   /number=3
FT   intron          5348..5648
FT                   /note="TNF intron C"
XX
SQ   Sequence 7112 BP; 1676 A; 2005 C; 1865 G; 1566 T; 0 other;
     gaattctcga aacttccttt gtagaaaact ttggaaggtg tctgccacat tgatcctgga        60
     atgtgtgttt atttggggtt atataaatct gttctgtgga agccacctga agtcaggaag       120
     agatggaggg catccttcag gagtgagatg agacctcatc atacttgact gtccagcatc       180
     atctctgagt gaggggacca aaaaatttat cttccaaact aggacacttt caagagtgga       240
     agggggatcc attaatattt tcacctggac aagaggcaaa caccagaatg tccccgatga       300
     aggggatata taatggacct tcttgatgtg aaacctgcca gatgggctgg aaagtccgta       360
     tactgggaca agtatgattt gagttgtttg ggacaaggac aggggtacaa gagaaggaaa       420
     tgggcaaaga gagaagcctg tactcagcca agggtgcaga gatgttatat atgattgctc       480
     ttcagggaac cgggcctcca gctcacaccc cagctgctca accacctcct ctctgaattg       540
     actgtccctt ctttggaact ctaggcctga ccccactccc tggccctccc agcccacgat       600
     tcccctgacc cgactccctt tcccagaact cagtcgcctg aacccccagc ctgtggttct       660
     ctcctaggcc tcagcctttc ctgcctttga ctgaaacagc agtatcttct aagccctggg       720
     ggcttccccg ggccccagcc ccgacctaga acccgcccgc tgcctgccac gctgccactg       780
     ccgcttcctc tataaaggga cctgagcgtc cgggcccagg ggctccgcac agcaggtgag       840
     gctctcctgc cccatctcct tgggctgccc gtgcttcgtg ctttggacta ccgcccagca       900
     gtgtcctgcc ctctgcctgg gcctcggtcc ctcctgcacc tgctgcctgg atccccggcc       960
     tgcctgggcc tgggccttgg tgggtttggt tttggtttcc ttctctgtct ctgactctcc      1020
     atctgtcagt ctcattgtct ctgtcacaca ttctctgttt ctgccatgat tcctctctgt      1080
     tcccttcctg tctctctctg tctccctctg ctcaccttgg ggtttctctg actgcatctt      1140
     gtccccttct ctgtcgatct ctctctcggg ggtcgggggg tgctgtctcc cagggcggga      1200
     ggtctgtctt ccgccgcgtg ccccgccccg ctcactgtct ctctctctct ctctctttct      1260
     ctgcaggttc tccccatgac accacctgaa cgtctcttcc tcccaagggt gtgtggcacc      1320
     accctacacc tcctccttct ggggctgctg ctggttctgc tgcctggggc ccaggtgagg      1380
     cagcaggaga atgggggctg ctggggtggc tcagccaaac cttgagccct agagcccccc      1440
     tcaactctgt tctcccctag gggctccctg gtgttggcct cacaccttca gctgcccaga      1500
     ctgcccgtca gcaccccaag atgcatcttg cccacagcac cctcaaacct gctgctcacc      1560
     tcattggtaa acatccacct gacctcccag acatgtcccc accagctctc ctcctacccc      1620
     tgcctcagga acccaagcat ccacccctct cccccaactt cccccacgct aaaaaaaaca      1680
     gagggagccc actcctatgc ctccccctgc catcccccag gaactcagtt gttcagtgcc      1740
     cacttcctca gggattgaga cctctgatcc agacccctga tctcccaccc ccatccccta      1800
     tggctcttcc taggagaccc cagcaagcag aactcactgc tctggagagc aaacacggac      1860
     cgtgccttcc tccaggatgg tttctccttg agcaacaatt ctctcctggt ccccaccagt      1920
     ggcatctact tcgtctactc ccaggtggtc ttctctggga aagcctactc tcccaaggcc      1980
     acctcctccc cactctacct ggcccatgag gtccagctct tctcctccca gtaccccttc      2040
     catgtgcctc tcctcagctc ccagaagatg gtgtatccag ggctgcagga accctggctg      2100
     cactcgatgt accacggggc tgcgttccag ctcacccagg gagaccagct atccacccac      2160
     acagatggca tcccccacct agtcctcagc cctagtactg tcttctttgg agccttcgct      2220
     ctgtagaact tggaaaaatc cagaaagaaa aaataattga tttcaagacc ttctccccat      2280
     tctgcctcca ttctgaccat ttcaggggtc gtcaccacct ctcctttggc cattccaaca      2340
     gctcaagtct tccctgatca agtcaccgga gctttcaaag aaggaattct aggcatccca      2400
     ggggaccaca cctccctgaa ccatccctga tgtctgtctg gctgaggatt tcaagcctgc      2460
     ctaggaattc ccagcccaaa gctgttggtc ttgtccacca gctaggtggg gcctagatcc      2520
     acacacagag gaagagcagg cacatggagg agcttggggg atgactagag gcagggaggg      2580
     gactatttat gaaggcaaaa aaattaaatt atttatttat ggaggatgga gagaggggaa      2640
     taatagaaga acatccaagg agaaacagag acaggcccaa gagatgaaga gtgagagggc      2700
     atgcgcacaa ggctgaccaa gagagaaaga agtaggcatg agggatcaca gggccccaga      2760
     aggcagggaa aggctctgaa agccagctgc cgaccagagc cccacacgga ggcatctgca      2820
     ccctcgatga agcccaataa acctcttttc tctgaaatgc tgtctgcttg tgtgtgtgtg      2880
     tctgggagtg agaacttccc agtctatcta aggaatggag ggagggacag agggctcaaa      2940
     gggagcaaga gctgtgggga gaacaaaagg ataagggctc agagagcttc agggatatgt      3000
     gatggactca ccaggtgagg ccgccagact gctgcagggg aagcaaagga gaagctgaga      3060
     agatgaagga aaagtcaggg tctggagggg cgggggtcag ggagctcctg ggagatatgg      3120
     ccacatgtag cggctctgag gaatgggtta caggagacct ctggggagat gtgaccacag      3180
     caatgggtag gagaatgtcc agggctatga aagtcgagta tggggacccc cccttaacga      3240
     agacagggcc atgtagaggg ccccagggag tgaaagagcc tccaggacct ccaggtatgg      3300
     aatacagggg acgtttaaga agatatggcc acacactggg gccctgagaa gtgagagctt      3360
     catgaaaaaa atcagggacc ccagagttcc ttggaagcca agactgaaac cagcattatg      3420
     agtctccggg tcagaatgaa agaagagggc ctgccccagt ggggtctgtg aattcccggg      3480
     ggtgatttca ctccccgggg ctgtcccagg cttgtccctg ctacccgcac ccagcctttc      3540
     ctgaggcctc aagcctgcca ccaagccccc agctccttct ccccgcaggg cccaaacaca      3600
     ggcctcagga ctcaacacag cttttccctc caaccccgtt ttctctccct caacggactc      3660
     agctttctga agcccctccc agttctagtt ctatcttttt cctgcatcct gtctggaagt      3720
     tagaaggaaa cagaccacag acctggtccc caaaagaaat ggaggcaata ggttttgagg      3780
     ggcatgggga cggggttcag cctccagggt cctacacaca aatcagtcag tggcccagaa      3840
     gacccccctc ggaatcggag cagggaggat ggggagtgtg aggggtatcc ttgatgcttg      3900
     tgtgtcccca actttccaaa tccccgcccc cgcgatggag aagaaaccga gacagaaggt      3960
     gcagggccca ctaccgcttc ctccagatga gctcatgggt ttctccacca aggaagtttt      4020
     ccgctggttg aatgattctt tccccgccct cctctcgccc cagggacata taaaggcagt      4080
     tgttggcaca cccagccagc agacgctccc tcagcaagga cagcagagga ccagctaaga      4140
     gggagagaag caactacaga ccccccctga aaacaaccct cagacgccac atcccctgac      4200
     aagctgccag gcaggttctc ttcctctcac atactgaccc acggcttcac cctctctccc      4260
     ctggaaagga caccatgagc actgaaagca tgatccggga cgtggagctg gccgaggagg      4320
     cgctccccaa gaagacaggg gggccccagg gctccaggcg gtgcttgttc ctcagcctct      4380
     tctccttcct gatcgtggca ggcgccacca cgctcttctg cctgctgcac tttggagtga      4440
     tcggccccca gagggaagag gtgagtgcct ggccagcctt catccactct cccacccaag      4500
     gggaaatgga gacgcaagag agggagagag atgggatggg tgaaagatgt gcgctgatag      4560
     ggagggatgg agagaaaaaa acgtggagaa agacggggat gcagaaagag atgtggcaag      4620
     agatggggaa gagagagaga gaaagatgga gagacaggat gtctggcaca tggaaggtgc      4680
     tcactaagtg tgtatggagt gaatgaatga atgaatgaat gaacaagcag atatataaat      4740
     aagatatgga gacagatgtg gggtgtgaga agagagatgg gggaagaaac aagtgatatg      4800
     aataaagatg gtgagacaga aagagcggga aatatgacag ctaaggagag agatggggga      4860
     gataaggaga gaagaagata gggtgtctgg cacacagaag acactcaggg aaagagctgt      4920
     tgaatgcctg gaaggtgaat acacagatga atggagagag aaaaccagac acctcagggc      4980
     taagagcgca ggccagacag gcagccagct gttcctcctt taagggtgac tccctcgatg      5040
     ttaaccattc tccttctccc caacagttcc ccagggacct ctctctaatc agccctctgg      5100
     cccaggcagt cagtaagtgt ctccaaacct ctttcctaat tctgggtttg ggtttggggg      5160
     tagggttagt accggtatgg aagcagtggg ggaaatttaa agttttggtc ttgggggagg      5220
     atggatggag gtgaaagtag gggggtattt tctaggaagt ttaagggtct cagctttttc      5280
     ttttctctct cctcttcagg atcatcttct cgaaccccga gtgacaagcc tgtagcccat      5340
     gttgtaggta agagctctga ggatgtgtct tggaacttgg agggctagga tttggggatt      5400
     gaagcccggc tgatggtagg cagaacttgg agacaatgtg agaaggactc gctgagctca      5460
     agggaagggt ggaggaacag cacaggcctt agtgggatac tcagaacgtc atggccaggt      5520
     gggatgtggg atgacagaca gagaggacag gaaccggatg tggggtgggc agagctcgag      5580
     ggccaggatg tggagagtga accgacatgg ccacactgac tctcctctcc ctctctccct      5640
     ccctccagca aaccctcaag ctgaggggca gctccagtgg ctgaaccgcc gggccaatgc      5700
     cctcctggcc aatggcgtgg agctgagaga taaccagctg gtggtgccat cagagggcct      5760
     gtacctcatc tactcccagg tcctcttcaa gggccaaggc tgcccctcca cccatgtgct      5820
     cctcacccac accatcagcc gcatcgccgt ctcctaccag accaaggtca acctcctctc      5880
     tgccatcaag agcccctgcc agagggagac cccagagggg gctgaggcca agccctggta      5940
     tgagcccatc tatctgggag gggtcttcca gctggagaag ggtgaccgac tcagcgctga      6000
     gatcaatcgg cccgactatc tcgactttgc cgagtctggg caggtctact ttgggatcat      6060
     tgccctgtga ggaggacgaa catccaacct tcccaaacgc ctcccctgcc ccaatccctt      6120
     tattaccccc tccttcagac accctcaacc tcttctggct caaaaagaga attgggggct      6180
     tagggtcgga acccaagctt agaactttaa gcaacaagac caccacttcg aaacctggga      6240
     ttcaggaatg tgtggcctgc acagtgaagt gctggcaacc actaagaatt caaactgggg      6300
     cctccagaac tcactggggc ctacagcttt gatccctgac atctggaatc tggagaccag      6360
     ggagcctttg gttctggcca gaatgctgca ggacttgaga agacctcacc tagaaattga      6420
     cacaagtgga ccttaggcct tcctctctcc agatgtttcc agacttcctt gagacacgga      6480
     gcccagccct ccccatggag ccagctccct ctatttatgt ttgcacttgt gattatttat      6540
     tatttattta ttatttattt atttacagat gaatgtattt atttgggaga ccggggtatc      6600
     ctgggggacc caatgtagga gctgccttgg ctcagacatg ttttccgtga aaacggagct      6660
     gaacaatagg ctgttcccat gtagccccct ggcctctgtg ccttcttttg attatgtttt      6720
     ttaaaatatt tatctgatta agttgtctaa acaatgctga tttggtgacc aactgtcact      6780
     cattgctgag cctctgctcc ccaggggagt tgtgtctgta atcgccctac tattcagtgg      6840
     cgagaaataa agtttgctta gaaaagaaac atggtctcct tcttggaatt aattctgcat      6900
     ctgcctcttc ttgtgggtgg gaagaagctc cctaagtcct ctctccacag gctttaagat      6960
     ccctcggacc cagtcccatc cttagactcc tagggccctg gagaccctac ataaacaaag      7020
     cccaacagaa tattccccat cccccaggaa acaagagcct gaacctaatt acctctccct      7080
     cagggcatgg gaatttccaa ctctgggaat tc                                    7112
//