spacer

EBI Dbfetch

ID   M16394; SV 1; linear; genomic DNA; STD; MUS; 64 BP.
XX
AC   M16394; J00348;
XX
DT   29-JUL-1991 (Rel. 28, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 8)
XX
DE   Mouse alpha-fetoprotein (AFP) gene, exon 14.
XX
KW   alpha-fetoprotein; fetoprotein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-64
RX   PUBMED; 6161929.
RA   Gorin M.B., Cooper D.L., Eiferman F., van de Rijn P., Tilghman S.M.;
RT   "The evolution of alpha-fetoprotein and albumin. I. A comparison of the
RT   primary amino acid sequences of mammalian alpha-fetoprotein and albumin";
RL   J Biol Chem 256(4):1954-1959(1981).
XX
RN   [2]
RP   3-57
RX   DOI; 10.1038/291201a0.
RX   PUBMED; 6164927.
RA   Law S.W., Dugaiczyk A.;
RT   "Homology between the primary structure of alpha-fetoprotein, deduced from
RT   a complete cDNA sequence, and serum albumin";
RL   Nature 291(5812):201-205(1981).
XX
RN   [3]
RP   1-64
RX   DOI; 10.1038/294713a0.
RX   PUBMED; 6172714.
RA   Eiferman F.A., Young P.R., Scott R.W., Tilghman S.M.;
RT   "Intragenic amplification and divergence in the mouse alpha-fetoprotein
RT   gene";
RL   Nature 294(5843):713-718(1981).
XX
RN   [4]
RP   3-57
RX   PUBMED; 2452956.
RA   Minghetti P.P., Law S.W., Dugaiczyk A.;
RT   "The rate of molecular evolution of alpha-fetoprotein approaches that of
RT   pseudogenes";
RL   Mol. Biol. Evol. 2(4):347-358(1985).
XX
DR   MD5; d42e8954eea6916a8cf8e8217fa8f185.
DR   Ensembl-Gn; ENSMUSG00000054932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042755; mus_musculus.
XX
CC   [4]  revises [2].
CC   Computer-readable sequence for [2],[4] kindly provided by
CC   A.Dugaiczyk, 05-MAY-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..64
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   intron          <1..2
FT                   /gene="Afp"
FT                   /number=13
FT   CDS             join(M16381.1:81..165,M16382.1:8..59,M16383.1:8..128,
FT                   M16384.1:1..212,M16385.1:1..133,M16386.1:8..105,
FT                   M16387.1:1..130,M16388.1:1..215,M16389.1:8..140,
FT                   M16390.1:1..98,M16391.1:8..146,M16392.1:8..231,
FT                   M16393.1:8..140,3..47)
FT                   /codon_start=1
FT                   /gene="Afp"
FT                   /product="alpha-fetoprotein"
FT                   /note="precursor"
FT                   /db_xref="GOA:P02772"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR001703"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87951"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02772"
FT                   /protein_id="AAA37189.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   mat_peptide     join(M16381.1:141..165,M16382.1:8..59,M16383.1:8..128,
FT                   M16384.1:1..212,M16385.1:1..133,M16386.1:8..105,
FT                   M16387.1:1..130,M16388.1:1..215,M16389.1:8..140,
FT                   M16390.1:1..98,M16391.1:8..146,M16392.1:8..231,
FT                   M16393.1:8..140,3..44)
FT                   /gene="Afp"
FT                   /product="alpha-fetoprotein"
FT   exon            3..57
FT                   /gene="Afp"
FT                   /number=14
FT   intron          58..>64
FT                   /gene="Afp"
FT                   /number=14
XX
SQ   Sequence 64 BP; 19 A; 12 C; 15 G; 18 T; 0 other;
     agggtccaaa gttgatttcc aaaactcgtg atgctttggg cgtttaaaca tctccaggta        60
     agaa                                                                     64
//


spacer
spacer