Dbfetch

ID   AH001842; SV 2; linear; genomic DNA; STD; MUS; 3604 BP.
XX
AC   AH001842; J00348; M16381-M16395;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus alpha-fetoprotein (Afp) gene, complete cds.
XX
KW   alpha-fetoprotein; fetoprotein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3604
RX   PUBMED; 6161929.
RA   Gorin M.B., Cooper D.L., Eiferman F., van de Rijn P., Tilghman S.M.;
RT   "The evolution of alpha-fetoprotein and albumin. I. A comparison of the
RT   primary amino acid sequences of mammalian alpha-fetoprotein and albumin";
RL   J Biol Chem 256(4):1954-1959(1981).
XX
RN   [2]
RP   40-165,280-331,446-566,674-885,993-1125,1233-1330,1438-1567,1675-1889,
RP   1997-2129,2237-2334,2442-2580,2695-2918,3026-3158,3268-3322,3437-3484
RX   DOI; 10.1038/291201a0.
RX   PUBMED; 6164927.
RA   Law S.W., Dugaiczyk A.;
RT   "Homology between the primary structure of alpha-fetoprotein, deduced from
RT   a complete cDNA sequence, and serum albumin";
RL   Nature 291(5812):201-205(1981).
XX
RN   [3]
RP   1-172,273-287,324-338,439-452,558-573,674-682,878-892,993-999,1117-1125,
RP   1226-1241,1323-1337,1438-1444,1559-1574,1675-1683,1882-1889,1990-2003,
RP   2121-2136,2237-2245,2327-2334,2435-2448,2572-2587,2688-2703,2911-2918,
RP   3019-3032,3150-3165,3266-3329,3430-3604
RX   DOI; 10.1038/294713a0.
RX   PUBMED; 6172714.
RA   Eiferman F.A., Young P.R., Scott R.W., Tilghman S.M.;
RT   "Intragenic amplification and divergence in the mouse alpha-fetoprotein
RT   gene";
RL   Nature 294(5843):713-718(1981).
XX
RN   [4]
RP   3268-3322
RX   PUBMED; 2452956.
RA   Minghetti P.P., Law S.W., Dugaiczyk A.;
RT   "The rate of molecular evolution of alpha-fetoprotein approaches that of
RT   pseudogenes";
RL   Mol. Biol. Evol. 2(4):347-358(1985).
XX
DR   MD5; 468dc243f444c12467dd95c2c6dec3a9.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:191747,
CC   gi:476713, gi:191749, gi:191750, gi:191751, gi:191752, gi:191753,
CC   gi:191754, gi:191755, gi:191756, gi:191757, gi:191758, gi:191759,
CC   gi:191760, gi:191761, gi:476714.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3604
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            37..3576
FT                   /gene="Afp"
FT   exon            37..165
FT                   /gene="Afp"
FT                   /number=1
FT   CDS             join(81..165,280..331,446..566,674..885,993..1125,
FT                   1233..1330,1438..1567,1675..1889,1997..2129,2237..2334,
FT                   2442..2580,2695..2918,3026..3158,3268..3312)
FT                   /codon_start=1
FT                   /gene="Afp"
FT                   /product="alpha-fetoprotein"
FT                   /note="precursor"
FT                   /protein_id="AAA37189.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   sig_peptide     81..140
FT                   /gene="Afp"
FT   mat_peptide     join(141..165,280..331,446..566,674..885,993..1125,
FT                   1233..1330,1438..1567,1675..1889,1997..2129,2237..2334,
FT                   2442..2580,2695..2918,3026..3158,3268..3309)
FT                   /gene="Afp"
FT                   /product="alpha-fetoprotein"
FT   intron          166..>172
FT                   /gene="Afp"
FT                   /number=1
FT   gap             173..272
FT                   /estimated_length=unknown
FT   intron          <273..279
FT                   /gene="Afp"
FT                   /number=1
FT   exon            280..331
FT                   /gene="Afp"
FT                   /number=2
FT   intron          332..>338
FT                   /gene="Afp"
FT                   /number=2
FT   gap             339..438
FT                   /estimated_length=unknown
FT   intron          <439..445
FT                   /gene="Afp"
FT                   /number=2
FT   exon            446..566
FT                   /gene="Afp"
FT                   /number=3
FT   intron          567..>573
FT                   /gene="Afp"
FT                   /number=3
FT   gap             574..673
FT                   /estimated_length=unknown
FT   exon            674..885
FT                   /gene="Afp"
FT                   /number=4
FT   intron          886..>892
FT                   /gene="Afp"
FT                   /number=4
FT   gap             893..992
FT                   /estimated_length=unknown
FT   exon            993..1125
FT                   /gene="Afp"
FT                   /number=5
FT   gap             1126..1225
FT                   /estimated_length=unknown
FT   intron          <1226..1232
FT                   /gene="Afp"
FT                   /number=5
FT   exon            1233..1330
FT                   /gene="Afp"
FT                   /number=6
FT   intron          1331..>1337
FT                   /gene="Afp"
FT                   /number=6
FT   gap             1338..1437
FT                   /estimated_length=unknown
FT   exon            1438..1567
FT                   /gene="Afp"
FT                   /number=7
FT   intron          1568..>1574
FT                   /gene="Afp"
FT                   /number=7
FT   gap             1575..1674
FT                   /estimated_length=unknown
FT   exon            1675..1889
FT                   /gene="Afp"
FT                   /number=8
FT   gap             1890..1989
FT                   /estimated_length=unknown
FT   intron          <1990..1996
FT                   /gene="Afp"
FT                   /number=8
FT   exon            1997..2129
FT                   /gene="Afp"
FT                   /number=9
FT   intron          2130..>2136
FT                   /gene="Afp"
FT                   /number=9
FT   gap             2137..2236
FT                   /estimated_length=unknown
FT   exon            2237..2334
FT                   /gene="Afp"
FT                   /number=10
FT   gap             2335..2434
FT                   /estimated_length=unknown
FT   intron          <2435..2441
FT                   /gene="Afp"
FT                   /number=10
FT   exon            2442..2580
FT                   /gene="Afp"
FT                   /number=11
FT   intron          2581..>2587
FT                   /gene="Afp"
FT                   /number=11
FT                   /note="putative"
FT   gap             2588..2687
FT                   /estimated_length=unknown
FT   intron          <2688..2695
FT                   /gene="Afp"
FT                   /number=11
FT   exon            2695..2918
FT                   /gene="Afp"
FT                   /number=12
FT   gap             2919..3018
FT                   /estimated_length=unknown
FT   intron          <3019..3025
FT                   /gene="Afp"
FT                   /number=12
FT   exon            3026..3158
FT                   /gene="Afp"
FT                   /number=13
FT   intron          3159..>3165
FT                   /gene="Afp"
FT                   /number=13
FT   gap             3166..3265
FT                   /estimated_length=unknown
FT   intron          <3266..3267
FT                   /gene="Afp"
FT                   /number=13
FT   exon            3268..3322
FT                   /gene="Afp"
FT                   /number=14
FT   intron          3323..>3329
FT                   /gene="Afp"
FT                   /number=14
FT   gap             3330..3429
FT                   /estimated_length=unknown
FT   intron          <3430..3436
FT                   /gene="Afp"
FT                   /number=14
FT   exon            3437..3576
FT                   /gene="Afp"
FT                   /number=15
XX
SQ   Sequence 3604 BP; 645 A; 494 C; 525 G; 540 T; 1400 other;
     acaggatata aaaggacttc agcaggactg ctcgaaacat cccacttcca gcactgcctg        60
     cggtgaagga acaagcagcc atgaagtgga tcacacccgc ttccctcatc ctcctgctac       120
     atttcgctgc gtccaaagca ttgcacgaaa atgagtttgg gataggtaag atnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnttttcagc ttccacgtta gattcctccc       300
     agtgcgtgac ggagaagaat gtgcttagca tgtaagttnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnct tgcagagcta ccatcacctt tacccagttt gttccggaag       480
     ccaccgagga ggaagtgaac aaaatgacta gcgatgtgtt ggctgcaatg aagaaaaact       540
     ctggcgatgg gtgtttagaa agccaggtga gtgnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnctatctg tgtttctgga tgaaatttgc catgagacgg aactctctaa       720
     caagtatgga ctctcaggct gctgcagcca aagtggagtg gaaagacatc agtgtctgct       780
     ggcacgcaag aagactgctc cggcctctgt cccacccttc cagtttccag aacctgccga       840
     gagttgcaaa gcacatgaag aaaacagggc agtgttcatg aacaggtaag gannnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngttcatct atgaagtgtc aaggaggaac      1020
     cccttcatgt atgccccagc cattctgtcc ttggctgctc agtacgacaa ggtcgttctg      1080
     gcatgctgca aagctgacaa caaggaggag tgcttccaga caaagnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnncatct agagagcatc cattgcaaag gaattaagag      1260
     aaggaagcat gttaaatgag catgtatgtt cagtgataag aaaatttgga tcccgaaacc      1320
     tccaggcaac gtaagtannn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnaac      1440
     cattattaag ctaagtcaaa agttaactga agcaaatttt actgagattc agaagctggc      1500
     cctggatgtg gctcacatcc acgaggagtg ttgccaagga aactcgctgg agtgtctgca      1560
     ggatggggta ggagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngaaaaa      1680
     gtcatgacat atatatgttc tcaacaaaat attctgtcaa gcaaaatagc agagtgctgc      1740
     aaattaccca tgatccaact aggcttctgc ataattcacg cagagaatgg cgtcaaacct      1800
     gaaggcttat ctctaaatcc aagccagttt ttgggagaca gaaattttgc ccaattttct      1860
     tcagaggaaa aaatcatgtt catggcaagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnna tttaagcttt cttcatgaat actcaagaac tcaccccaac cttcctgtct      2040
     cagtcattct aagaattgct aaaacgtacc aggaaatatt ggagaagtgt tcccagtctg      2100
     gaaatctacc tggatgtcag gacaatctgg taggttnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnngaag aagaattgca gaaacacatc gaggagagcc aggcactgtc      2280
     caagcaaagc tgcgctctct accagacctt aggagactac aaattacaaa atctnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnncttcaa ggttccttat tggttacacg      2460
     aggaaagccc ctcagctgac ctcagcagag ctgatcgacc tcaccgggaa gatggtgagc      2520
     attgcctcca cgtgctgcca gctcagcgag gagaaatggt ccggctgtgg tgagggaatg      2580
     gtgagtgnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnntta acaggccgac      2700
     attttcattg gacatttgtg tataaggaat gaagcaagcc ctgtgaactc tggtatcagc      2760
     cactgctgca actcttcgta ttccaacagg aggctatgca tcaccagttt tctgagggat      2820
     gaaacctatg cccctccccc attctctgag gataaattca tcttccacaa ggatctgtgc      2880
     caagctcagg gcaaagccct acagaccatg aaacaagann nnnnnnnnnn nnnnnnnnnn      2940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3000
     nnnnnnnnnn nnnnnnnnac cccaggcttc tcattaacct ggtgaagcaa aagcctgaac      3060
     tgacagagga gcagctggcg gctgtcactg cagatttctc gggccttttg gagaagtgct      3120
     gcaaagccca ggaccaggaa gtctgtttca cagaagaggt gcgtannnnn nnnnnnnnnn      3180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3240
     nnnnnnnnnn nnnnnnnnnn nnnnnagggt ccaaagttga tttccaaaac tcgtgatgct      3300
     ttgggcgttt aaacatctcc aggtaagaan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3420
     nnnnnnnnna ttgcagaagg aagagtggac aaaaaaatgt gttgacgctt tggtgtgagc      3480
     cttttggctt aactgtaact gctagtactt taaccacatg gtgaagatgt ccatgtgaga      3540
     tttctatacc ttaggaataa aaacttttca actatttctc ttctcctagt ctgctttttt      3600
     ttat                                                                   3604
//