spacer

EBI Dbfetch

ID   M16111; SV 1; linear; mRNA; STD; MUS; 1254 BP.
XX
AC   M16111;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mouse alpha-fetoprotein mRNA, partial cds.
XX
KW   alpha-fetoprotein; serum albumin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1254
RX   PUBMED; 2452956.
RA   Minghetti P.P., Law S.W., Dugaiczyk A.;
RT   "The rate of molecular evolution of alpha-fetoprotein approaches that of
RT   pseudogenes";
RL   Mol. Biol. Evol. 2(4):347-358(1985).
XX
DR   MD5; 7d96f0a9b6e56ba05c69b7e8077da689.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
XX
CC   Nucleotide number 1 in the sequence is equivalent to nucleotide 333
CC   of the rat albumin cDNA sequence
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by A.Dugaiczyk, 17-JUN-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>1254
FT                   /codon_start=1
FT                   /note="alpha-fetoprotein"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /protein_id="AAA37190.1"
FT                   /translation="CAIPNLRENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPE
FT                   AEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCL
FT                   TPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATD
FT                   LTKVNKECCHGDLLECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHD
FT                   TMPADLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEA
FT                   TLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQK
FT                   APQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHV
FT                   TKCCSGSLVERRPCFSALT"
XX
SQ   Sequence 1254 BP; 347 A; 303 C; 309 G; 295 T; 0 other;
     tgtgccattc caaacctccg tgaaaactat ggtgaactgg ctgactgctg tacaaaacaa        60
     gagcccgaaa gaaacgaatg tttcctgcaa cacaaagatg acaaccccag cctgccacca       120
     tttgaaaggc cagaggctga ggccatgtgc acctccttta aggaaaaccc aaccaccttt       180
     atgggacact atttgcatga agttgccaga agacatcctt atttctatgc cccagaactt       240
     ctttactatg ctgagcagta caatgagatt ctgacccagt gttgtgcaga ggctgacaag       300
     gaaagctgcc tgaccccgaa gcttgatggt gtgaaggaga aagctttggt ctcatctgtc       360
     cgtcagagaa tgaagtgctc cagtatgcag aagtttggag agagagcttt taaagcatgg       420
     gcagtagctc gtctgagcca gacattcccc aatgctgact ttgcagaaat caccaaattg       480
     gcaacagacc tgaccaaagt caacaaggag tgctgccatg gtgacctgct ggaatgcgca       540
     gatgacaggg cggaacttgc caagtacatg tgtgaaaacc aggcgactat ctccagcaaa       600
     ctgcagactt gctgcgataa accactgttg aagaaagccc actgtcttag tgaggtggag       660
     catgacacca tgcctgctga tctgcctgcc attgctgctg attttgttga ggaccaggaa       720
     gtgtgcaaga actatgctga ggccaaggat gtcttcttgg gcacgttctt gtatgaatat       780
     tcaagaagac accctgatta ctctgtatcc ctgttgctga gacttgctaa gaaatatgaa       840
     gccactctgg aaaagtgctg cgctgaagcc aatcctcccg catgctacgg cacagtgctt       900
     gctgaatttc agcctcttgt agaagagcct aagaacttgg tcaaaaccaa ctgtgatctt       960
     tacgagaagc ttggagaata tggattccaa aatgccattc tagttcgcta cacccagaaa      1020
     gcacctcagg tgtcaacccc aactctcgtg gaggctgcaa gaaacctagg aagagtgggc      1080
     accaagtgtt gtacacttcc tgaagatcag agactccctt gtgtggaaga ctatctgtct      1140
     gcaatcctga accgtgtgtg tctgctgcat gagaagaccc cagtgagtga gcatgttacc      1200
     aagtgctgta gtggatccct ggtggaaagg cggccatgct tctctgctct gaca            1254
//


spacer
spacer