spacer

EBI Dbfetch

ID   M15839; SV 1; linear; genomic DNA; STD; HUM; 111 BP.
XX
AC   M15839;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 10)
XX
DE   Human HLA-DR beta gene, exon 4 from clone lambda-DR4.0.
XX
KW   antigen; cell surface glycoprotein; class II antigen; glycoprotein;
KW   histocompatibility antigen; major histocompatibility complex;
KW   surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-111
RX   DOI; 10.1007/BF00372296.
RX   PUBMED; 3015788.
RA   Owerbach D., Rich C., Taneja K.;
RT   "Characterization of three HLA-DR beta genes isolated from an HLA-DR 3/4
RT   insulin-dependent diabetic patient";
RL   Immunogenetics 24(1):41-46(1986).
XX
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
CC   Clean copy of sequence [1] kindly provided by D.Owerbach
CC   (22-APR-1987).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..111
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            join(M15373.1:1..270,M15377.1:1..282,1..111)
FT                   /gene="HLA-DRB4"
FT   CDS             join(M15373.1:1..270,M15377.1:1..282,1..111)
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-DRB4"
FT                   /note="HLA-DR beta-chain"
FT                   /db_xref="GOA:O19678"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19678"
FT                   /protein_id="AAA58651.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQK"
FT   exon            1..111
FT                   /gene="HLA-DRB4"
FT                   /number=4
FT                   /note="G00-120-645"
XX
SQ   Sequence 111 BP; 21 A; 25 C; 38 G; 27 T; 0 other;
     gagcacggtc tgaatctgca cagagcaaga tgctgagtgg agtcgggggc tttgtgctgg        60
     gcctgctctt ccttggggcc gggctgttca tctacttcag gaatcagaaa g                111
//


spacer
spacer