Dbfetch

ID   M15268; SV 1; linear; mRNA; STD; MUS; 1896 BP.
XX
AC   M15268;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mouse 5-aminolevulinic acid synthase mRNA, 3' end.
XX
KW   5-aminolevulinic acid synthetase; synthetase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1896
RX   DOI; 10.1016/0378-1119(86)90351-3.
RX   PUBMED; 3557128.
RA   Schoenhaut D.S., Curtis P.J.;
RT   "Nucleotide sequence of mouse 5-aminolevulinic acid synthase cDNA and
RT   expression of its gene in hepatic and erythroid tissues";
RL   Gene 48(1):55-63(1986).
XX
DR   MD5; d0dd8616bd92b345e66a662f550887ab.
DR   Ensembl-Gn; ENSMUSG00000025270; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036169; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0036145; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0036071; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0036136; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035844; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036661; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0035134; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035821; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035913; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0036070; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035949; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036696; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034829; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035270; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000066337; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097713; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0097789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0097737; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097708; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0097264; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0098226; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0097181; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0097406; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0097222; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0097428; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0097165; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098593; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0097269; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0096223; mus_musculus_wsbeij.
XX
CC   It is unlikely that there are different isozymic forms of ALA
CC   synthase in mouse erythroid and hepatic tissues.  The mouse liver
CC   cDNA codes for an enzyme which is functional in E.coli, but is 103
CC   amino acids shorter at the N-terminus than the erythroid sequence.
CC   Therefore, the first 100 amino acids are not essential for an
CC   active enzyme.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1896
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..1896
FT                   /note="ALA mRNA"
FT   sig_peptide     <1..231
FT                   /note="5-aminolevulinic acid synthase signal peptide"
FT   CDS             <1..1761
FT                   /codon_start=1
FT                   /note="5-aminolevulinic acid synthase (EC 2.3.1.37)"
FT                   /db_xref="GOA:P08680"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015118"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="PDB:1H7D"
FT                   /db_xref="PDB:1H7J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08680"
FT                   /protein_id="AAA37207.1"
FT                   /translation="WFVLSAGQQDFGLRMVAAAMLLRSCPVLSQGPTGLLGKVAKTYQF
FT                   LFSIGRCPILATQGPTCSQIHLKATKAGGELQDRKSKIVQRAAPEVQEDVKTFKTDLLS
FT                   TMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYRV
FT                   FKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGA
FT                   GGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDA
FT                   GNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLE
FT                   ELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYI
FT                   ASTRDLVDMVRSYAAGFIFTTSLPPMMLSGALESVRLLKGEEGQALRRAHQRNVKHMRQ
FT                   LLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRL
FT                   APSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFGN
FT                   MGPQYVTTYA"
FT   mat_peptide     232..1758
FT                   /note="5-aminolevulinic acid"
XX
SQ   Sequence 1896 BP; 445 A; 511 C; 484 G; 456 T; 0 other;
     tggttcgtcc tcagtgcagg gcaacaggac tttgggctca ggatggtggc agcagctatg        60
     ttgctacggt cctgtccagt gctctctcag ggccccacag gcctcctggg caaagtggct       120
     aaaacctacc agttcctatt tagtattgga cgctgcccca tcctggccac tcaaggacca       180
     acctgttctc aaatccatct taaggcaacc aaggctggag gagaactcca agacaggaag       240
     agcaagattg tgcagagggc agctccagaa gttcaagagg atgtcaagac tttcaagaca       300
     gacctgctga gcaccatgga ttcaaccacc cgaagccatt catttcctag tttccaggag       360
     ccagagcaga ctgaaggggc agttccccac ctgattcaga acaatatgac tggaagccag       420
     gctttcggtt atgaccaatt tttcagagac aagatcatgg agaagaaaca ggaccacacc       480
     taccgtgtgt tcaagactgt gaatcgttgg gctaatgcct acccctttgc ccaacacttc       540
     tccgaggcat ctatggcatc aaaggatgtt tctgtttggt gtagtaatga ctatttgggc       600
     ataagcagac accctcgtgt cttgcaggcc atagaggaga ccctgaagaa tcatggagct       660
     ggagctgggg gcactcgcaa tatctcaggt accagcaagt ttcatgtgga gcttgaacag       720
     gagctggctg aactacacca gaaagactca gctctgctct tctcctcctg ttttgtggcc       780
     aatgattcta ctctctttac actggccaag cttctgccag ggtgtgagat ctactcagat       840
     gcaggcaatc atgcctccat gatccaaggc attcgcaaca gtggtgcagc caagtttgtc       900
     ttcagacaca atgacccagg ccacctgaag aaacttctcg agaagtctga tcccaagaca       960
     ccaaaaattg tggcttttga gactgttcat tccatggatg gtgccatctg tcctctggag      1020
     gaattgtgtg atgtggccca ccagtatgga gccctgacct tcgtagatga agtccatgct      1080
     gtaggactgt atggagcccg gggtgcaggt atcggggagc gtgatggaat tatgcacaag      1140
     cttgacatca tctctggaac tcttggcaag gcctttggtt gcgtcggtgg ctatatagcc      1200
     agcactcggg acttggtgga catggtgcgc tcctacgctg caggcttcat ctttaccact      1260
     tcactgcctc ccatgatgct ctctggggct ctagaatctg tgcgcctact caagggagag      1320
     gagggtcaag ccctgaggcg ggcacaccag cgcaatgtca aacacatgcg ccagctgcta      1380
     atggacaggg gctttcctgt tatcccctgt cccagccaca tcatccccat cagggtgggt      1440
     aatgcagcac tcaacagcaa gatctgtgat cttctgctct ccaagcacag catctatgtg      1500
     caggccatca actacccaac tgtgcctcgt ggtgaggagc tactgcgctt ggccccctcc      1560
     ccccaccaca gccctcagat gatggaaaac tttgtggaga agctgctgct ggcctggact      1620
     gaggtggggc tgcccctcca agatgtgtct gtggctgcat gcaacttctg tcatcgtcct      1680
     gtgcactttg aacttatgag cgagtgggag cgatcctact ttgggaacat gggaccccaa      1740
     tatgttacca cctatgctta aggagccagc tgccttggat gccagctcca cctgcactcc      1800
     ccctggggct gggcttcctc ctgctctctg ctttcctgtg tgcttctggc tgacttgatt      1860
     ctgaaaataa agagcaactt gaaacattca taaaaa                                1896
//