Dbfetch

ID   AH002891; SV 2; linear; mRNA; STD; HUM; 418 BP.
XX
AC   AH002891; M15069; M15074;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens clone BIN40c15 MHC class II antigen (HLA-DRB1) mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-418
RX   DOI; 10.1073/pnas.83.8.2642.
RX   PUBMED; 3458223.
RA   Gregersen P.K., Shen M., Song Q.-L., Merryman P., Degar S., Seki T.,
RA   Maccari J., Goldberg D., Murphy H., Schwenzer J., Wang C.Y.,
RA   Winchester R.J., Nepom G.T., Silver J.;
RT   "Molecular diversity of HLA-DR4 haplotypes";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(8):2642-2646(1986).
XX
DR   MD5; 718284c7594d152fa2ccb514ab9f5eca.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:188357,
CC   gi:188358, gi:188359.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..418
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="Dw14"
FT                   /clone="BIN40c15"
FT                   /cell_line="DR4"
FT                   /cell_type="beta-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>418
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="cell surface glycoprotein; integral membrane
FT                   protein"
FT                   /protein_id="AAA59809.1"
FT                   /translation="GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   gap             283..382
FT                   /estimated_length=unknown
FT   CDS             <383..418
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="cell surface glycoprotein; integral membrane
FT                   protein"
FT                   /protein_id="AAA59810.1"
FT                   /translation="HSGLQPTGFLS"
XX
SQ   Sequence 418 BP; 71 A; 81 C; 110 G; 56 T; 100 other;
     ggggacaccc gaccacgttt cttggagcag gttaaacatg agtgtcattt cttcaacggg        60
     acggagcggg tgcggttcct ggacagatac ttctatcacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aggcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gannnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nncactctgg acttcagcca acaggattcc tgagctga         418
//