spacer

EBI Dbfetch

ID   M11867; SV 1; linear; mRNA; STD; HUM; 1097 BP.
XX
AC   M11867;
XX
DT   18-NOV-1986 (Rel. 10, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class II HLA DR5 DR-beta-chain mRNA, complete cds.
XX
KW   antigen; cell surface glycoprotein; class II gene; glycoprotein;
KW   histocompatibility antigen; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1097
RX   PUBMED; 3456344.
RA   Tieber V.L., Abruzzini L.F., Didier D.K., Schwartz B.D., Rotwein P.;
RT   "Complete characterization and sequence of an HLA class II DR beta chain
RT   cDNA from the DR5 haplotype";
RL   J Biol Chem 261(6):2738-2742(1986).
XX
DR   MD5; 879495c3ddcd41bb10b8068724e4ccbe.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   H-InvDB; HIT000194132_04.4.
XX
CC   Draft entry and sequence in computer readable form for [1] kindly
CC   provided by D.Didier, 30-APR-1986.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1097
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..1097
FT                   /note="DR-beta mRNA"
FT   sig_peptide     30..116
FT                   /note="MHC HLA DR5 cell surface glycoprotein beta chain
FT                   signal peptide"
FT   CDS             30..830
FT                   /codon_start=1
FT                   /note="MHC HLA DR5 cell surface glycoprotein beta chain
FT                   precursor"
FT                   /db_xref="GOA:P20039"
FT                   /db_xref="H-InvDB:HIT000194132_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*11:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20039"
FT                   /protein_id="AAA36274.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   mat_peptide     117..827
FT                   /note="MHC HLA DR5 cell surface glycoprotein beta chain"
XX
SQ   Sequence 1097 BP; 226 A; 291 C; 320 G; 260 T; 0 other;
     tggcccctgg tcctgtcctg ttctccagca tggtgtgtct gaggctccct ggaggctcct        60
     gcatggcagt tctgacagtg acactgatgg tgctgagctc cccactggct ttggctgggg       120
     acaccagacc acgtttcttg gagtactcta cgtctgagtg tcatttcttc aatgggacgg       180
     agcgggtgcg gttcctggac agatacttct ataaccaaga ggagtacgtg cgcttcgaca       240
     gcgacgtggg ggagttccgg gcggtgacgg agctggggcg gcctgatgag gagtactgga       300
     acagccagaa ggacttcctg gaagacaggc gggccgcggt ggacacctac tgcagacaca       360
     actacggggt tggtgagagc ttcacagtgc agcggcgagt ccatcctaag gtgactgtgt       420
     atccttcaaa gacccagccc ctgcagcacc acaacctcct ggtctgttct gtgagtggtt       480
     tctatccagg cagcattgaa gtcaggtggt tccggaatgg ccaggaagag aagactgggg       540
     tggtgtccac aggcctgatc cacaatggag actggacctt ccagaccctg gtgatgctgg       600
     aaacagttcc tcggagtgga gaggtttaca cctgccaagt ggagcaccca agcgtgacaa       660
     gccctctcac agtggaatgg agagcacggt ctgaatctgc acagagcaag atgctgagtg       720
     gagtcggggg ctttgtgctg ggcctgctct tccttggggc cgggctgttc atctacttca       780
     ggaatcagaa aggacactct ggacttcagc caagaggatt cctgagctga agtgcagatg       840
     acacattcaa agaagaactt tctgccccag ctttgcagga tgaaaagctt tccctcctgg       900
     ctgttattct tccacaagag agggctttct caggacctgg ttgctactgg ttcagcaact       960
     gcagaaaatg tcctcccttg tggcttcctc agctcctgtt cttggcctga agccccacag      1020
     ctttgatggc agcgcctcat cttcaacttt tgtgctcccc tttgcctaaa ccctatggcc      1080
     tcctgtgcat ctgtact                                                     1097
//


spacer
spacer