spacer

EBI Dbfetch

ID   M11161; SV 1; linear; mRNA; STD; HUM; 1132 BP.
XX
AC   M11161;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA DR-beta chain mRNA (DR1) from cell line LG2.
XX
KW   class II gene; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1132
RX   DOI; 10.1073/pnas.82.10.3405.
RX   PUBMED; 3858829.
RA   Bell J.I., Estess P., John T., Saiki R., Watling D.L., Erlich H.A.,
RA   McDevitt H.O.;
RT   "DNA sequence and characterization of human class II major
RT   histocompatibility complex beta chains from the DR1 haplotype";
RL   Proc. Natl. Acad. Sci. U.S.A. 82(10):3405-3409(1985).
XX
DR   MD5; 1fdfccbcaeb022540e4b87a607c239c7.
XX
CC   NCBI gi: 188238
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1132
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..801
FT                   /map="6p21.3"
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="MHC DR-beta;  NCBI gi: 307265"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="H-InvDB:HIT000194105.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4C56"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="AAA59781.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSRLALAGDTRPRFLWQLKFECH
FT                   FFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVEELGRPDAEYWNSQKDLLEQKRGQV
FT                   DNYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLEIVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 1132 BP; 257 A; 284 C; 328 G; 263 T; 0 other;
     atggtgtgtc tgaagctccc tggaggctcc tgcatgacag cgctgacagt gacactgatg        60
     gtgctgagct cccgactggc tttggctggg gacacccgac cacgtttctt gtggcagctt       120
     aagtttgaat gtcatttctt caatgggacg gagcgggtgc ggttgctgga aagatgcatc       180
     tataaccaag aggagtccgt gcgcttcgac agcgacgtgg gggagtaccg ggcggttgag       240
     gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacctcct ggagcagaag       300
     cggggccagg tggacaatta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag ttgagcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca cgggcctgat ccagaatgga       540
     gattggacct tccagaccct ggtgatgctg gaaatagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagtgtgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gcttcgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg aaatgcagat gaaccacatt caaggaagaa ccttctgtcc       840
     cagctttgca gaatgaaaag ctttcctgct tggcagttat tcttccacaa gagagggctt       900
     tctcaggacc tggttgctac tggttcggca actgcagaaa atgttcctcc cttgtggctt       960
     cctcagctcc tgcccttggc ctgaagtccc agcattgatg acagcgcctc atcttcagct      1020
     tttgtgctcc cctttgccta aaccgtatgg cctcccgtgc atctgtactc accctgtacg      1080
     acaaacacat tacattatta aatgtttctc aaagatggag ttaaaaaaaa aa              1132
//


spacer
spacer