Dbfetch

ID   M10988; SV 1; linear; mRNA; STD; HUM; 1585 BP.
XX
AC   M10988;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Human tumor necrosis factor (TNF) mRNA.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1585
RX   DOI; 10.1126/science.3856324.
RX   PUBMED; 3856324.
RA   Wang A.M., Creasey A.A., Ladner M.B., Lin L.S., Strickler J.,
RA   Van Arsdell J.N., Yamamoto R., Mark D.F.;
RT   "Molecular cloning of the complementary DNA for human tumor necrosis
RT   factor";
RL   Science, e1252229 228(4696):149-154(1985).
XX
DR   MD5; bc434d8532456ce7aaf2530d787e6712.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC120037; 12093702.
DR   EuropePMC; PMC1489004; 16648466.
DR   EuropePMC; PMC1526630; 16542506.
DR   EuropePMC; PMC2533489; 18573939.
DR   EuropePMC; PMC3679321; 23525947.
DR   EuropePMC; PMC3887204; 24275664.
DR   EuropePMC; PMC4245402; 25427999.
DR   EuropePMC; PMC4363195; 25654296.
DR   EuropePMC; PMC4490755; 26137941.
DR   EuropePMC; PMC55886; 11522838.
DR   H-InvDB; HIT000194094_05.4.
DR   H-InvDB; HIT000194094_06.4.
DR   H-InvDB; HIT000194094_07.4.
DR   H-InvDB; HIT000194094_08.4.
DR   H-InvDB; HIT000194094_09.4.
DR   H-InvDB; HIT000194094_10.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1585
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             86..787
FT                   /codon_start=1
FT                   /gene="TNFA"
FT                   /note="tumor necrosis factor"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="H-InvDB:HIT000194094_04.4"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAA61198.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREESPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
XX
SQ   Sequence 1585 BP; 352 A; 473 C; 389 G; 371 T; 0 other;
     cacaccctga caagctgcca ggcaggttct cttcctctca catactgacc cacggctcca        60
     ccctctctcc cctggaaagg acaccatgag cactgaaagc atgatccggg acgtggagct       120
     ggccgaggag gcgctcccca agaagacagg ggggccccag ggctccaggc ggtgcttgtt       180
     cctcagcctc ttctccttcc tgatcgtggc aggcgccacc acgctcttct gcctgctgca       240
     ctttggagtg atcggccccc agagggaaga gtcccccagg gacctctctc taatcagccc       300
     tctggcccag gcagtcagat catcttctcg aaccccgagt gacaagcctg tagcccatgt       360
     tgtagcaaac cctcaagctg aggggcagct ccagtggctg aaccgccggg ccaatgccct       420
     cctggccaat ggcgtggagc tgagagataa ccagctggtg gtgccatcag agggcctgta       480
     cctcatctac tcccaggtcc tcttcaaggg ccaaggctgc ccctccaccc atgtgctcct       540
     cacccacacc atcagccgca tcgccgtctc ctaccagacc aaggtcaacc tcctctctgc       600
     catcaagagc ccctgccaga gggagacccc agagggggct gaggccaagc cctggtatga       660
     gcccatctat ctgggagggg tcttccagct ggagaagggt gaccgactca gcgctgagat       720
     caatcggccc gactatctcg actttgccga gtctgggcag gtctactttg ggatcattgc       780
     cctgtgagga ggacgaacat ccaaccttcc caaacgcctc ccctgcccca atccctttat       840
     taccccctcc ttcagacacc ctcaacctct tctggctcaa aaagagaatt gggggcttag       900
     ggtcggaacc caagcttaga actttaagca acaagaccac cacttcgaaa cctgggattc       960
     aggaatgtgt ggcctgcaca gtgaagtgct ggcaaccact aagaattcaa actggggcct      1020
     ccagaactca ctggggccta cagctttgat ccctgacatc tggaatctgg agaccaggga      1080
     gcctttggtt ctggccagaa tgctgcagga cttgagaaga cctcacctag aaattgacac      1140
     aagtggacct taggccttcc tctctccaga tgtttccaga cttccttgag acacggagcc      1200
     cagccctccc catggagcca gctccctcta tttatgtttg cacttgtgat tatttattat      1260
     ttatttatta tttatttatt tacagatgaa tgtatttatt tgggagaccg gggtatcctg      1320
     ggggacccaa tgtaggagct gccttggctc agacatgttt tccgtgaaaa cggaggctga      1380
     acaataggct gttcccatgt agccccctgg cctctgtgcc ttcttttgat tatgtttttt      1440
     aaaatattat ctgattaagt tgtctaaaca atgctgattt ggtgaccaac tgtcactcat      1500
     tgctgaggcc tctgctcccc agggagttgt gtctgtaatc ggcctactat tcagtggcga      1560
     gaaataaagg ttgcttagga aagaa                                            1585
//