spacer

EBI Dbfetch

ID   L48015; SV 1; linear; mRNA; STD; MUS; 1962 BP.
XX
AC   L48015;
XX
DT   18-OCT-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus activin type IB receptor (ALK-1) mRNA, complete cds.
XX
KW   activin type IB receptor; ALK-1 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1210/en.136.6.2652.
RX   PUBMED; 7750489.
RA   Dewulf N., Verschueren K., Lonnoy O., Moren A., Grimsby S., Spiegle K.,
RA   Miyazono K., Huylebroeck D., ten Dijke P.;
RT   "Distinct spatial and temporal expression patterns of two type I receptors
RT   for bone morphogenetic proteins during mouse embryogenesis";
RL   Endocrinology 136(6):2652-2663(1995).
XX
RN   [2]
RP   1-1962
RX   DOI; 10.1006/bbrc.1995.2594.
RX   PUBMED; 7488127.
RA   Wu X., Robinson C.E., Fong H.W., Crabtree J.S., Rodriguez B.R., Roe B.A.,
RA   Gimble J.M.;
RT   "Cloning and characterization of the murine activin receptor like kinase-1
RT   (ALK-1) homolog";
RL   Biochem. Biophys. Res. Commun. 216(1):78-83(1995).
XX
DR   MD5; 5190c1f26bdd5e5ed5a40fab14ac6e2c.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
DR   EuropePMC; PMC523004; 15501793.
XX
CC   ref [1] reports bases 1..2068 ref [2] reports bases 1..1909.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1962
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="bgt11 murine lung cDNA"
FT                   /clone="mALK-1"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             275..1783
FT                   /codon_start=1
FT                   /gene="ALK-1"
FT                   /product="activin type IB receptor"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61288"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61288"
FT                   /protein_id="AAB03642.1"
FT                   /translation="MTLGSFRRGLLMLSVAFGLTRGDLRRPSKLVNCTCESPHCKRPFC
FT                   QGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEA
FT                   TQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLIL
FT                   KASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHG
FT                   ESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEH
FT                   GSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSN
FT                   LQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWA
FT                   FGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
FT                   VLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH"
FT   sig_peptide     275..337
FT                   /codon_start=1
FT                   /gene="ALK-1"
FT                   /note="putative"
FT   mat_peptide     338..1780
FT                   /codon_start=1
FT                   /gene="ALK-1"
FT                   /product="activin type IB receptor"
FT                   /note="putative"
FT   misc_difference 370
FT                   /gene="ALK-1"
FT                   /replace="g"
FT                   /note="corresponds to position 291 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 379
FT                   /gene="ALK-1"
FT                   /replace="cc"
FT                   /note="corresponds to position 300-301 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 397..398
FT                   /gene="ALK-1"
FT                   /replace="g"
FT                   /note="corresponds to position 318 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 487
FT                   /gene="ALK-1"
FT                   /replace="a"
FT                   /note="corresponds to position 408 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 562
FT                   /gene="ALK-1"
FT                   /replace="g"
FT                   /note="corresponds to position 483 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 730
FT                   /gene="ALK-1"
FT                   /replace="g"
FT                   /note="corresponds to position 651 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 865
FT                   /gene="ALK-1"
FT                   /replace="c"
FT                   /note="corresponds to position 786 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 958
FT                   /gene="ALK-1"
FT                   /replace="c"
FT                   /note="corresponds to position 879 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 988
FT                   /gene="ALK-1"
FT                   /replace="a"
FT                   /note="corresponds to position 909 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 991
FT                   /gene="ALK-1"
FT                   /replace="c"
FT                   /note="corresponds to position 912 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 1232
FT                   /gene="ALK-1"
FT                   /replace="c"
FT                   /note="corresponds to position 1153 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 1392
FT                   /gene="ALK-1"
FT                   /replace="a"
FT                   /note="corresponds to position 1313 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 1396
FT                   /gene="ALK-1"
FT                   /replace="g"
FT                   /note="corresponds to position 1317 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
FT   misc_difference 1416..1417
FT                   /gene="ALK-1"
FT                   /replace="ca"
FT                   /note="corresponds to position 1337-1338 of Z31664"
FT                   /note="conflict"
FT                   /citation=[1]
XX
SQ   Sequence 1962 BP; 423 A; 563 C; 578 G; 398 T; 0 other;
     ggggagcaga cactctcagc ccaaactcag ctttcttagc gctgttcctt aggagtgagc        60
     acagcccctt cccagtcccc ggaggccgcc gcgccagccg cgcagatcga gacctttccc       120
     ggccccacag gccggctctg gacgtgagac cccggccgcc tccggcaagg agaggcgggg       180
     gtcgagtcgc cctgtccaaa ggaggagacc ttggtcacca cagctatcac gttttgcaga       240
     tctcaccaca tctcttctcc tatctccaag gaccatgacc ttggggagct tcagaagggg       300
     ccttttgatg ctgtcggtgg cctttggcct aaccagggga gacttgcgaa ggccttccaa       360
     gctggtgaac tgcacttgtg agagcccaca ctgcaagaga ccattctgcc aggggtcatg       420
     gtgcacagtg gtgctggttc gggagcaggg caggcacccc caggtctatc ggggctgtgg       480
     gagcctgaac caggagctct gcttgggacg tcccacagag tttctgaacc atcactgctg       540
     ctatagatcc ttctgcaacc acaacgtgtc tctgatgctg gaggccaccc aaactccttc       600
     ggaggagcca gaagttgatg cccatctgcc tctgatcctg ggtcctgtgc tggccttgcc       660
     ggtcctggtg gccctgggtg ctctaggctt gtggcgtgtc cggcggaggc aggagaagca       720
     gcgggatttg cacagtgacc tgggcgagtc cagtctcatc ctgaaggcat ctgaacaggc       780
     agacagcatg ttgggggact tcctggacag cgactgtact acgggcagcg gctcggggct       840
     ccccttcttg gtgcagagga cggtagctcg gcaggttgcg ctggtagagt gtgtgggaaa       900
     gggccgatat ggtgaggtgt ggcgcggttc gtggcatggc gagagtgtgg cggtcaagat       960
     tttctcctca cgagatgagc agtcctggtt ccgggagacg gagatctaca acacagttct      1020
     gcttagacac gacaacatcc taggcttcat cgcctccgac atgacttcgc ggaactcgag      1080
     cacgcagctg tggctcatca cccactacca tgaacacggc tccctctatg actttctgca      1140
     gaggcagacg ctggagcccc agttggccct gaggctagct gtgtccgcgg cctgcggcct      1200
     ggcgcaccta catgtggaga tctttggcac tcaaggcaaa ccagccattg cccatcgtga      1260
     cctcaagagt cgcaatgtgc tggtcaagag taacttgcag tgttgcattg cagacctggg      1320
     actggctgtg atgcactcac aaagcagcga ttacctggat atcggcaaca acccccgagt      1380
     gggtaccaaa agatacatgg cacccgaggt gctggatgag cacatccgca cagactgctt      1440
     tgagtcgtac aagtggacag acatctgggc ctttggccta gtgctatggg agatcgcccg      1500
     gcggaccatc atcaatggca ttgtggagga ttacaggcca cctttctatg acatggtacc      1560
     caatgacccc agttttgagg acatgaaaaa ggtggtgtgc gttgaccagc agacacccac      1620
     catccctaac cggctggctg cagatccggt cctctccggg ctggcccaga tgatgagaga      1680
     gtgctggtac cccaacccct ctgctcgcct caccgcactg cgcataaaga agacattgca      1740
     gaagctcagt cacaatccag agaagcccaa agtgattcac tagcccaggg ccaccaggct      1800
     tcctctgcct aaagtgtgtg ctggggcaga agacatagcc tgtctgggta gagggagtga      1860
     agagagtgtg cacgctgccc tgtgtgtgcc tgctcagctt ggctcccagc ccatccagcc      1920
     aaaaatacag ctgagctgaa attcaaaaaa aaaaaaaaac cg                         1962
//


spacer
spacer