Dbfetch

ID   L42338; SV 1; linear; mRNA; STD; MUS; 1362 BP.
XX
AC   L42338;
XX
DT   28-MAY-1995 (Rel. 43, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mus musculus sodium channel 25 mRNA, complete cds.
XX
KW   sodium channel 25.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1362
RA   Jover E., Shah V.;
RT   "Mouse sodium channel 25 in m13mp19";
RL   Unpublished.
XX
DR   MD5; 85d7ca626de72be3ab81bc1368b75642.
DR   Ensembl-Gn; ENSMUSG00000075316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164384; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1362
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   5'UTR           <1..22
FT   mRNA            <1..>1362
FT   CDS             22..951
FT                   /codon_start=1
FT                   /product="sodium channel 25"
FT                   /db_xref="GOA:Q62205"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001696"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR010526"
FT                   /db_xref="InterPro:IPR024583"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028803"
FT                   /db_xref="MGI:MGI:107636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62205"
FT                   /protein_id="AAA67106.1"
FT                   /translation="MFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPKKVHP
FT                   GSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEM
FT                   FYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLD
FT                   ILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATIIQRA
FT                   YRRYRLRQNVKNISSIYIKDGDRDDDLPNKEDIVFDNVNENSSPEKTDATASTISPPSY
FT                   DSVTKPDQEKYETDKTEKEDKEKDESRK"
FT   3'UTR           952..>1362
XX
SQ   Sequence 1362 BP; 411 A; 311 C; 296 G; 344 T; 0 other;
     ggcaaagctg gaattaatga catgttcaac tttgagacct tcggcaacag catgatctgc        60
     ctgttccaaa tcaccacctc tgcgggctgg gatggactgc tggcccccat cctcaacagt       120
     gcacctcctg actgtgaccc aaaaaaggtt cacccaggaa gttcagtgga aggggactgt       180
     ggaaatccat ctgtgggaat tttctacttt gtcagctaca tcatcatatc cttcctggtt       240
     gtggtgaaca tgtacattgc tgtcatcctg gagaacttca gcgttgccac agaagaaagt       300
     actgagcccc tgagtgagga cgactttgag atgttctacg aggtctggga gaagtttgac       360
     cctgacgcca cccagttcat agagttctgc aagctctctg actttgcagc agccctggat       420
     ccgcccctcc tcatcgcaaa gccaaacaaa gtgcagctca ttgccatgga cctgcccatg       480
     gtgagtggag accgcatcca ctgcctggac atcttatttg cttttacaaa gcgggtcctg       540
     ggcgagagcg gagagatgga ttcccttcgt tcacagatgg aagaaaggtt tatgtcagcc       600
     aatccttcta aagtgtccta tgagcccatc acaaccacac tgaagcgaaa acaagaggat       660
     gtatctgcga ctatcattca gcgtgcttac agacggtacc gccttaggca aaacgtcaag       720
     aatatatcaa gtatatatat aaaagatgga gacagagatg acgatttgcc caataaagaa       780
     gatatagttt ttgataatgt taacgagaac tcaagtccag aaaagacaga tgcaacagcc       840
     tctaccatct ctccaccttc ctatgacagt gtcacaaagc cagatcaaga gaaatatgaa       900
     acagacaaaa cggagaagga agacaaagag aaagacgaaa gcaggaaata gagcttcggt       960
     tttgatacac tgtttacagc ctgcgaaggt gactcactcg tgttaataag actcttttac      1020
     ggaggtctat gccaaactct ttttatcaaa tattctcaag gcagcacagc cactagctct      1080
     gatccagtga aacaagagag aagcatttac acatggctac tttttgcgtt ggtcaatgat      1140
     tctttaagaa ttgtgcgtgt aactctacag ggaataatca ttattgcaat caagggtgac      1200
     ttaatgattt taaatatcag aaaaccacat agaacatttt ctcttttgcc tccatttctt      1260
     tccctagatt ctaagtagat gtgtacccat gtgaatatag aaattcaggc gcacatgctc      1320
     acagtcacaa acacaaacag gattagctgt gatttggaat tc                         1362
//