spacer

EBI Dbfetch

ID   L41992; SV 1; linear; genomic DNA; STD; HUM; 434 BP.
XX
AC   L41992;
XX
DT   09-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II HLA-DRB1 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; HLA-DRB1 gene;
KW   integral membrane protein; major histocompatibility complex; MHC class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-434
RA   Maurer D.H.;
RT   ;
RL   Unpublished.
XX
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..434
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="94B148903"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="white blood cells"
FT                   /db_xref="taxon:9606"
FT   gene            1..434
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>434
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="major histocompatibility complex"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:21:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAA65914.1"
FT                   /translation="RLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNG
FT                   TERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPSAEYWNSQKDFLEDRRAAVDTYC
FT                   RHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSV"
XX
SQ   Sequence 434 BP; 88 A; 117 C; 139 G; 90 T; 0 other;
     aggctccctg gaggctcctg catggcagtt ctgacagtga cactgatggt gctgagctcc        60
     ccactggctt tggctgggga caccagacca cgtttcttgg agtactctac gtctgagtgt       120
     catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcta taaccaagag       180
     gagtacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga gctggggcgg       240
     cctagcgccg agtactggaa cagccagaag gacttcctgg aagacaggcg ggccgcggtg       300
     gacacctact gcagacacaa ctacggggtt ggtgagagct tcacagtgca gcggcgagtc       360
     catcctaagg tgactgtgta tccttcaaag acccagcccc tgcagcacca caacctcctg       420
     gtctgttctg tgag                                                         434
//


spacer
spacer