Dbfetch

ID   L36675; SV 1; linear; mRNA; STD; HUM; 369 BP.
XX
AC   L36675;
XX
DT   08-OCT-1994 (Rel. 41, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 5)
XX
DE   Human (clone 2-4) synuclein (NACP) mRNA, complete cds.
XX
KW   alternative splicing; amyloid precursor protein; NACP; synuclein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-369
RX   DOI; 10.1016/0888-7543(95)80208-4.
RX   PUBMED; 7601450.
RA   Campion D., Martin C., Heilig R., Charbonnier F., Moreau V., Flaman J.M.,
RA   Petit J.L., Hannequin D., Brice A., Frebourg T.;
RT   "The NACP/synuclein gene: chromosomal assignment and screening for
RT   alterations in Alzheimer disease";
RL   Genomics 26(2):254-257(1995).
XX
DR   MD5; 9668a8d5dd1e1461b12fcf6e87e93377.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
DR   Ensembl-Tr; ENST00000618500; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..369
FT                   /organism="Homo sapiens"
FT                   /map="chromosome 4"
FT                   /mol_type="mRNA"
FT                   /clone="2-4"
FT                   /cell_type="EBV-immortalized lymphocytes"
FT                   /db_xref="taxon:9606"
FT   gene            19..357
FT                   /gene="NACP"
FT   CDS             19..357
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="synuclein"
FT                   /note="non-Ab component of amyloid peptide precursor"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000193269.13"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2N0A"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /db_xref="PDB:4R0U"
FT                   /db_xref="PDB:4R0W"
FT                   /db_xref="PDB:4RIK"
FT                   /db_xref="PDB:4RIL"
FT                   /db_xref="PDB:4ZNN"
FT                   /db_xref="PDB:5CRW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="AAA98487.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEG
FT                   YQDYEPEA"
XX
SQ   Sequence 369 BP; 120 A; 61 C; 122 G; 66 T; 0 other;
     taaaggaatt cattagccat ggatgtattc atgaaaggac tttcaaaggc caaggaggga        60
     gttgtggctg ctgctgagaa aaccaaacag ggtgtggcag aagcagcagg aaagacaaaa       120
     gagggtgttc tctatgtagg ctccaaaacc aaggagggag tggtgcatgg tgtggcaaca       180
     gtggctgaga agaccaaaga gcaagtgaca aatgttggag gagcagtggt gacgggtgtg       240
     acagcagtag cccagaagac agtggaggga gcagggagca ttgcagcagc cactggcttt       300
     gtcaaaaagg accagttggg caaggaaggg tatcaagact acgaacctga agcctaagaa       360
     atatctttg                                                               369
//