spacer

EBI Dbfetch

ID   L36674; SV 1; linear; mRNA; STD; HUM; 411 BP.
XX
AC   L36674;
XX
DT   08-OCT-1994 (Rel. 41, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 5)
XX
DE   Human (clone 2-5) synuclein (NACP) mRNA, complete cds.
XX
KW   alternative splicing; amyloid precursor protein; NACP; synuclein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1073/pnas.90.23.11282.
RX   PUBMED; 8248242.
RA   Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M.,
RA   Otero D.A., Kondo J., Ihara Y., Saitoh T.;
RT   "Molecular cloning of cDNA encoding an unrecognized component of amyloid in
RT   Alzheimer disease";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(23):11282-11286(1993).
XX
RN   [2]
RP   1-411
RX   DOI; 10.1016/0888-7543(95)80208-4.
RX   PUBMED; 7601450.
RA   Campion D., Martin C., Heilig R., Charbonnier F., Moreau V., Flaman J.M.,
RA   Petit J.L., Hannequin D., Brice A., Frebourg T.;
RT   "The NACP/synuclein gene: chromosomal assignment and screening for
RT   alterations in Alzheimer disease";
RL   Genomics 26(2):254-257(1995).
XX
RN   [3]
RP   1-411
RA   Campion D., Martin C., Heilig C., Charbonnier F., Moreau V., Flaman J.-M.,
RA   Petit J.-L., Hannequin D., Brice A., Frebourg T.;
RT   "The NACP/synuclein gene: chromosomal assignment and screening for
RT   alterations in Alzheimer's disease";
RL   Unpublished.
XX
DR   MD5; df962ff59c39d407561e8ead4aa83a1d.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..411
FT                   /organism="Homo sapiens"
FT                   /map="chromosome 4"
FT                   /mol_type="mRNA"
FT                   /clone="2-5"
FT                   /cell_type="EBV-immortalized lymphocytes"
FT                   /db_xref="taxon:9606"
FT   gene            19..399
FT                   /gene="NACP"
FT   CDS             19..399
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="synuclein"
FT                   /note="non-Ab component of amyloid peptide precursor"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000193268.12"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="AAA98493.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVVAEKT
FT                   KEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPV
FT                   DPDNEAYEMPSEEGYQDYEPEA"
XX
SQ   Sequence 411 BP; 135 A; 68 C; 130 G; 78 T; 0 other;
     taaaggaatt cattagccat ggatgtattc atgaaaggac tttcaaaggc caaggaggga        60
     gttgtggctg ctgctgagaa aaccaaacag ggtgtggcag aagcagcagg aaagacaaaa       120
     gagggtgttc tctatgtagt ggctgagaag accaaagagc aagtgacaaa tgttggagga       180
     gcagtggtga cgggtgtgac agcagtagcc cagaagacag tggagggagc agggagcatt       240
     gcagcagcca ctggctttgt caaaaaggac cagttgggca agaatgaaga aggagcccca       300
     caggaaggaa ttctggaaga tatgcctgtg gatcctgaca atgaggctta tgaaatgcct       360
     tctgaggaag ggtatcaaga ctacgaacct gaagcctaag aaatatcttt g                411
//


spacer
spacer