spacer

EBI Dbfetch

ID   L31580; SV 1; linear; mRNA; STD; MUS; 2072 BP.
XX
AC   L31580; L31501;
XX
DT   10-APR-1994 (Rel. 39, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus G protein-coupled receptor (EBI 1) mRNA, complete cds.
XX
KW   G protein-coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2072
RX   DOI; 10.1006/geno.1994.1553.
RX   PUBMED; 7851893.
RA   Schweickart V.L., Raport C.J., Godiska R., Byers M.G., Eddy R.L.Jr.,
RA   Shows T.B., Gray P.W.;
RT   "Cloning of human and mouse EBI1, a lymphoid-specific G-protein-coupled
RT   receptor encoded on human chromosome 17q12-q21.2";
RL   Genomics 23(3):643-650(1994).
XX
DR   MD5; 44558359d58c46b3c7b4c2e06b4ce712.
DR   Ensembl-Gn; ENSMUSG00000037944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103134; mus_musculus.
DR   EuropePMC; PMC155249; 11779835.
DR   EuropePMC; PMC2132769; 9585422.
DR   EuropePMC; PMC3157898; 21628331.
DR   EuropePMC; PMC434242; 15226448.
XX
CC   On Feb 8, 2002 this sequence version replaced gi:468338.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2072
FT                   /organism="Mus musculus"
FT                   /strain="B6/CBAF1J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="6-8 weeks"
FT                   /tissue_lib="Stratagene #935303"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..175
FT                   /gene="EBI 1"
FT   CDS             176..1312
FT                   /codon_start=1
FT                   /gene="EBI 1"
FT                   /product="G protein-coupled receptor"
FT                   /db_xref="GOA:P47774"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR001718"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:103011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47774"
FT                   /protein_id="AAA74232.1"
FT                   /translation="MDPGKPRKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYE
FT                   SVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYIYFKRLKTMTDTYLLNLAVAD
FT                   ILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVS
FT                   RHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSGEDTLRCSLVSAQVEALIT
FT                   IQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNG
FT                   VVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKL
FT                   FKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP"
FT   3'UTR           1310..2072
FT                   /gene="EBI 1"
FT   polyA_site      2072
FT                   /gene="EBI 1"
XX
SQ   Sequence 2072 BP; 482 A; 585 C; 528 G; 477 T; 0 other;
     ggacatggac tgctatctgc gtcgcctcaa acaggagctg atgtccatga aggaggtggg        60
     ggatggcttg caggatcaga tgaactgcat gatgggcgca gactgggcta gctggagaga       120
     gacaagaacc aaaagcacag ccttcctgtg tgatttctac agcccccaga gcaccatgga       180
     cccagggaaa cccaggaaaa acgtgctggt ggtggctctc cttgtcattt tccaggtgtg       240
     cttctgccaa gatgaggtca ccgatgacta catcggcgag aataccacgg tggactacac       300
     cctgtacgag tcggtgtgct tcaagaagga tgtgcggaac tttaaggcct ggttcctgcc       360
     tctcatgtat tctgtcatct gcttcgtggg cctgctcggc aacgggctgg tgatactgac       420
     gtacatctat ttcaagaggc tcaagaccat gacggatacc tacctgctca acctggccgt       480
     ggcagacatc cttttcctcc taattcttcc cttctgggcc tacagcgaag ccaagtcctg       540
     gatctttggc gtctacctgt gtaagggcat ctttggcatc tataagttaa gcttcttcag       600
     cgggatgctg ctgctcctat gcatcagcat tgaccgctac gtagccatcg tccaggccgt       660
     gtcgcgtcat cgccaccgcg cccgcgtgct tctcatcagc aagctgtcct gtgtgggcat       720
     ctggatgctg gccctcttcc tctccatccc ggagctgctc tacagcggcc tccagaagaa       780
     cagcggcgag gacacgctga gatgctcact ggtcagtgcc caagtggagg ccttgatcac       840
     catccaagtg gcccagatgg tttttgggtt cctagtgcct atgctggcta tgagtttctg       900
     ctacctcatt atcatccgta ccttgctcca ggcacgcaac tttgagcgga acaaggccat       960
     caaggtgatc attgccgtgg tggtagtctt catagtcttc cagctgccct acaatggggt      1020
     ggtcctggct cagacggtgg ccaacttcaa catcaccaat agcagctgcg aaaccagcaa      1080
     gcagctcaac attgcctatg acgtcaccta cagcctggcc tccgtccgct gctgcgtcaa      1140
     ccctttcttg tatgccttca tcggcgtcaa gttccgcagc gacctcttca agctcttcaa      1200
     ggacttgggc tgcctcagcc aggaacggct ccggcactgg tcttcctgcc ggcatgtacg      1260
     gaacgcgtcg gtgagcatgg aggcggagac caccacaacc ttctccccgt agggggctcc      1320
     cctgcccgga ctacaaggac ctctcccagg agccttaatg tggtgcacac atgcacagac      1380
     tctccatcca ccgaattgct gctgagggaa gagcaattct ggccagtcag gttgacatga      1440
     ggacctaaga aactgcttaa ccccatccca cttataacta cctcaaccaa agctgtaaaa      1500
     gatatggctg agaagttaac actcaagcca agacagctat ccccaaaacg acagccaaaa      1560
     gtgaaagtga gaggctccac actttccgga gtgagggatg tggggccagt gaacaccctg      1620
     gttgagtagt cttcggaggc ctctgaatga acctgcttct agcttagaga gatgtcccgg      1680
     agattcaaga cagagcttat ctccacactt agcaagcaag caagagatga cagtctctct      1740
     aaatgctccc acagagcacc cctgcccctc ccttctgcct ctccaccgcc tttcctgagg      1800
     tccaggccac accatgacgc tgaggcagtc ccagctgggg ctctggatgg caatgacaag      1860
     tagttgggtc tctatgatgg gaataaaaag gtaggggaaa ggtgacagga aggagagaag      1920
     gtgaccctgc tggctgacag aggccagcaa gctacttctt tgttctctgt cagccagcca      1980
     ctgatacctt tcctcatgtt ctgcttttga ttcatatatc ttttatgaag aaacaaataa      2040
     aaaaaaaatt ttccctcgag gaaacaactt gg                                    2072
//


spacer
spacer