spacer

EBI Dbfetch

ID   L28116; SV 1; linear; mRNA; STD; MUS; 1542 BP.
XX
AC   L28116;
XX
DT   04-FEB-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus peroxisome proliferator-activated receptor mRNA, complete cds.
XX
KW   peroxisome proliferator-activated receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1542
RX   DOI; 10.1074/jbc.270.5.2367.
RX   PUBMED; 7836471.
RA   Amri E.Z., Bonino F., Ailhaud G., Abumrad N.A., Grimaldi P.A.;
RT   "Cloning of a protein that mediates transcriptional effects of fatty acids
RT   in preadipocytes. Homology to peroxisome proliferator-activated receptors";
RL   J Biol Chem 270(5):2367-2371(1995).
XX
DR   MD5; 40593dd6ee9847472fcda90312941a60.
DR   Ensembl-Gn; ENSMUSG00000002250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002320; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1542
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /haplotype="OB/OB"
FT                   /cell_line="OB1771"
FT                   /cell_type="preadipocyte, adipocyte"
FT                   /tissue_lib="lambda ZAP II"
FT                   /tissue_type="adipose"
FT                   /db_xref="taxon:10090"
FT   mRNA            1..1542
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             58..1380
FT                   /codon_start=1
FT                   /product="peroxisome proliferator-activated receptor"
FT                   /note="member of steroide hormone receptor superfamily;
FT                   putative"
FT                   /db_xref="GOA:P35396"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003075"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:101884"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35396"
FT                   /protein_id="AAA63394.1"
FT                   /translation="MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLS
FT                   QNSSPSSLLDQLQMGCDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMK
FT                   LEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASE
FT                   GCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAE
FT                   KGLVWKQLVNGLPPYNEISVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLL
FT                   KYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNAL
FT                   ELDDSDLALFIAAIILCGDRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLL
FT                   QKMADLRQLVTEHAQMMQWLKKTESETLLHPLLQEIYKDMY"
FT   misc_feature    271..468
FT                   /note="DNA-binding domain"
XX
SQ   Sequence 1542 BP; 361 A; 490 C; 432 G; 259 T; 0 other;
     agatggtggc agagctatga ccaggcctgc aggcgccacg ccaagtgggg gtcagtcatg        60
     gaacagccac aggaggagac ccctgaggcc cgggaagagg agaaagagga agtggccatg       120
     ggtgacggag ccccggagct caatggggga ccagaacaca cgcttccttc cagcagctgt       180
     gcagacctct cccagaattc ctccccttcc tccctgctgg accagctgca gatgggctgt       240
     gatggggcct caggcggcag cctcaacatg gaatgtcggg tgtgcgggga caaggcctcg       300
     ggcttccact acggggtcca cgcgtgcgag gggtgcaagg gcttcttccg ccggacaatc       360
     cgcatgaagc tcgagtatga gaagtgcgat cggatctgca agatccagaa gaagaaccgc       420
     aacaagtgtc agtactgccg cttccagaag tgcctggcac tcggcatgtc gcacaacgct       480
     atccgctttg gacggatgcc ggaggccgag aagaggaagc tggtggcggg gctgactgcc       540
     agcgaggggt gccagcacaa cccccagctg gccgacctga aggccttctc taagcacatc       600
     tacaacgcct acctgaaaaa cttcaacatg accaaaaaga aggcccggag catcctcacc       660
     ggcaagtcca gccacaacgc accctttgtc atccacgaca tcgagacact gtggcaggca       720
     gagaagggcc tggtgtggaa acagctggtg aacgggctgc cgccctacaa cgagatcagt       780
     gtgcacgtgt tctaccgctg ccagtccacc acagtggaga cagtccgaga gctcaccgag       840
     ttcgccaaga acatccccaa cttcagcagc ctcttcctca atgaccaggt gaccctcctc       900
     aagtatggcg tgcacgaggc catctttgcc atgctggcct ccatcgtcaa caaagacggg       960
     ctgctggtgg ccaacggcag tggcttcgtc acccacgagt tcttgcgaag tctccgcaag      1020
     cccttcagtg acatcattga gcccaagttc gagtttgctg tcaagttcaa tgcgctggag      1080
     ctcgatgaca gtgacctggc gctcttcatc gcggccatca ttctgtgtgg agaccggcca      1140
     ggcctcatga atgtgcccca ggtagaagcc atccaggaca ccattctgcg ggctctagaa      1200
     ttccatctgc aggtcaacca ccctgacagc cagtacctct tccccaagct gctgcagaag      1260
     atggcagacc tgcggcagct ggtcactgag catgcccaga tgatgcagtg gctaaagaag      1320
     acggagagtg agaccttgct gcaccccctg ctccaggaaa tctacaagga catgtactaa      1380
     ggccgcagcc caggcctccc ctcaggctct gctgggccca gccacggact gttcagagga      1440
     ccagccacag gcactggcag tcaagcagct agagcctact cacaacactc cagacacgtg      1500
     gcccagactc tcccccaaca cccccacccc caccaacccc cc                         1542
//


spacer
spacer