spacer

EBI Dbfetch

ID   L20339; SV 1; linear; mRNA; STD; MUS; 654 BP.
XX
AC   L20339;
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse serotonin-1A receptor homologue mRNA, partial cds.
XX
KW   serotonin 1A receptor; serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-654
RX   DOI; 10.1006/geno.1993.1452.
RX   PUBMED; 8288218.
RA   Wilkie T.M., Chen Y., Gilbert D.J., Moore K.J., Yu L., Simon M.I.,
RA   Copeland N.G., Jenkins N.A.;
RT   "Identification, chromosomal location, and genome organization of mammalian
RT   G-protein-coupled receptors";
RL   Genomics 18(2):175-184(1993).
XX
DR   MD5; 20216c8aca3b9961fe0264573f3f1d1a.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..654
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>654
FT                   /codon_start=1
FT                   /product="serotonin 1A receptor"
FT                   /note="homologue; putative"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="AAA16850.1"
FT                   /translation="WAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
FT                   RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAG
FT                   TSLGTSSVPPPKKSLNGQPGSGDWRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRV
FT                   GNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGT"
XX
SQ   Sequence 654 BP; 150 A; 196 C; 197 G; 111 T; 0 other;
     tgggcaatca ccgaccctat agactacgtg aacaagagga cgccccggcg cgccgctgcg        60
     ctgatctcgc tcacttggct cattggcttt ctcatctcca tcccgcctat gctgggctgg       120
     cgcaccccgg aagaccgctc gaaccccaac gagtgcacca tcagcaagga ccacgggtac       180
     accatctact ccactttcgg cgctttctat atcccgctgc tgctcatgct ggtcctctat       240
     gggcgcatct tcagagccgc acgcttccga atccgcaaga cggtcaagaa ggtggaaaag       300
     aagggagcag gcaccagctt aggaacatcg tcggtaccgc cccccaagaa gagcctgaat       360
     ggacagccag gtagtgggga ctggaggcgc agtgctgaga acagggcggt ggggactccg       420
     tgcgctaatg gggcggtgag gcagggtgaa gacgacgcca ccctggaggt gatcgaggtg       480
     catcgagtgg gcaactccaa agggcacctt cctctgccca gcgaatcagg agctacctcc       540
     tatgtccccg cctgcttgga gagaaaaaat gagcgcactg ctgaggcaaa gcgcaagatg       600
     gccttggccc gtgagaggaa gacagtgaag acactgggca tcatcatggg cacc             654
//


spacer
spacer