spacer

EBI Dbfetch

ID   L20335; SV 1; linear; mRNA; STD; MUS; 516 BP.
XX
AC   L20335;
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse serotonin-1D receptor homologue mRNA, partial cds.
XX
KW   serotonin 1D receptor; serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-516
RX   DOI; 10.1006/geno.1993.1452.
RX   PUBMED; 8288218.
RA   Wilkie T.M., Chen Y., Gilbert D.J., Moore K.J., Yu L., Simon M.I.,
RA   Copeland N.G., Jenkins N.A.;
RT   "Identification, chromosomal location, and genome organization of mammalian
RT   G-protein-coupled receptors";
RL   Genomics 18(2):175-184(1993).
XX
DR   MD5; eaf01feb49ff2ca26d1989a3911f8eb2.
DR   Ensembl-Gn; ENSMUSG00000070687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121571; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..516
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>516
FT                   /codon_start=1
FT                   /product="serotonin 1D receptor"
FT                   /note="homologue; putative"
FT                   /db_xref="GOA:Q61224"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000505"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96276"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61224"
FT                   /protein_id="AAA16847.1"
FT                   /translation="WAITDALEYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAH
FT                   EEMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTT
FT                   AQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKAT
FT                   KTLGIILGA"
XX
SQ   Sequence 516 BP; 111 A; 178 C; 115 G; 112 T; 0 other;
     tgggccatca ccgatgccct ggagtacagc aagcgtcgaa ccgcaggcca cgcagcagcc        60
     atgattgcgg ccgtctggat catctctatt tgtatctcca tccctccgct cttctggcgg       120
     caggccacag ctcacgagga gatgtccgac tgcctggtga acacatctca gatttcttac       180
     accatctact cgacctgtgg cgccttctat atcccatcca tcttgctcat tatcctgtat       240
     ggccgcatat acgtggccgc ccggagccga atcctgaacc caccctccct ctacgggaag       300
     cgcttcacca cggcacagct tatcacaggc tctgctggct cttcgctctg ctcgctcaac       360
     cccagcctcc acgagagcca cacacacaca gttggctccc ctctcttttt caaccaggtg       420
     aaaatcaagc ttgctgatag catcctagaa cgcaagagga tctctgcagc ccgagaaagg       480
     aaagccacta agaccctggg catcattctg ggggcc                                 516
//


spacer
spacer