Dbfetch

ID   L20330; SV 1; linear; mRNA; STD; MUS; 483 BP.
XX
AC   L20330;
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse dopamine-1B receptor homologue mRNA, partial cds.
XX
KW   dopamine D1B receptor; dopamine receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-483
RX   DOI; 10.1006/geno.1993.1452.
RX   PUBMED; 8288218.
RA   Wilkie T.M., Chen Y., Gilbert D.J., Moore K.J., Yu L., Simon M.I.,
RA   Copeland N.G., Jenkins N.A.;
RT   "Identification, chromosomal location, and genome organization of mammalian
RT   G-protein-coupled receptors";
RL   Genomics 18(2):175-184(1993).
XX
DR   MD5; 44ba6e8543f15d5b5379b9b886fe337c.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029477; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028619; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029178; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029325; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028343; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028700; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071448; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071525; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071184; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070260; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..483
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>483
FT                   /codon_start=1
FT                   /product="dopamine D1B receptor"
FT                   /note="homologue; putative"
FT                   /db_xref="GOA:Q8BLD9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BLD9"
FT                   /protein_id="AAA16844.1"
FT                   /translation="WAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHRDK
FT                   AGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYILVAIMIVTYTR
FT                   IYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRASIKKETKVFKTLSVIMGV"
XX
SQ   Sequence 483 BP; 107 A; 151 C; 129 G; 96 T; 0 other;
     tgggctattt ccagaccctt ccgctacgag cgcaagatga cccagcgtgt agccctggtc        60
     atggtggccc tggcctggac cttgtccatc ctcatctcct ttatcccggt ccaactcaat       120
     tggcacagag acaaggcagg ctcccagggc cgagagggcc tgctgtccaa tgagacaccc       180
     tgggaggaag gttgggagct agacgggaga acagagaact gtgactccag cctgaaccga       240
     acctacgcca tctcctcgtc gctcatcagc ttctatatcc tggtagccat catgatagtg       300
     acctacacgc gcatctaccg cattgcacag gttcagatcc gccgtatctc ctccctagaa       360
     agggcagctg agcatgctca gagttgccgg agccgtgggg cctgcgaacc tgaccccagc       420
     ctgcgagcat ccatcaagaa ggagaccaag gtcttcaaaa ccctgtccgt gatcatgggg       480
     gtc                                                                     483
//