Dbfetch

ID   L14611; SV 1; linear; mRNA; STD; HUM; 1473 BP.
XX
AC   L14611;
XX
DT   04-OCT-1993 (Rel. 37, Created)
DT   08-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Human transcription factor RZR-alpha mRNA, complete cds.
XX
KW   nuclear receptor; transcription factor; transcription factor RZR-alpha;
KW   zinc finger.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1473
RX   DOI; 10.1006/bbrc.1993.1976.
RX   PUBMED; 7916608.
RA   Becker-Andre M., Delamarter J.F.;
RT   "Identification of nuclear receptor mRNAs by RT-PCR amplification of
RT   conserved zinc-finger motif sequences";
RL   Biochem. Biophys. Res. Commun. 194(3):1371-1379(1993).
XX
RN   [2]
RP   1-1473
RA   Becker-Andre M.;
RT   ;
RL   Submitted (20-APR-1993) to the INSDC.
RL   M. Becker-Andre, Glaxo Institute for Molecular Biology, Geneva, Switzerland
XX
DR   MD5; 360f45c75a5e756c8ff503dc8467a542.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="new-born"
FT                   /cell_type="umbilical vein endothelial cells"
FT                   /db_xref="taxon:9606"
FT   CDS             22..1428
FT                   /codon_start=1
FT                   /standard_name="RZR-a"
FT                   /product="transcription factor"
FT                   /note="putative"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000192253.14"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="PDB:4S15"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="AAA02963.1"
FT                   /translation="MMYFVIAEMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
FT                   QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAE
FT                   VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAV
FT                   SSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLA
FT                   QNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVE
FT                   FAKRIDGFMELCQNDQIVLLKAGSLEVVFIRVCRAFDSQNNTVYFDGKYASPDVFKSLG
FT                   CEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQ
FT                   HVLQKNHREDGMLTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTS
FT                   EFEPAMQIDG"
XX
SQ   Sequence 1473 BP; 453 A; 328 C; 331 G; 361 T; 0 other;
     cgctctccgc accgcgctta aatgatgtat tttgtgatcg cagagatgaa agctcaaatt        60
     gagattattc catgcaagat ctgtggagac aaatcatcag gaatccatta tggtgtcatt       120
     acatgtgaag gctgcaaggg ctttttcagg agaagtcagc aaagcaatgc cacctactcc       180
     tgtcctcgtc agaagaactg tttgattgat cgaaccagta gaaaccgctg ccaacactgt       240
     cgattacaga aatgccttgc cgtagggatg tctcgagatg ctgtaaaatt tggccgaatg       300
     tcaaaaaagc agagagacag cttgtatgca gaagtacaga aacaccggat gcagcagcag       360
     cagcgcgacc accagcagca gcctggagag gctgagccgc tgacgcccac ctacaacatc       420
     tcggccaacg ggctgacgga acttcacgac gacctcagta actacattga cgggcacacc       480
     cctgagggga gtaaggcaga ctccgccgtc agcagcttct acctggacat acagccttcc       540
     ccagaccagt caggtcttga tatcaatgga atcaaaccag aaccaatatg tgactacaca       600
     ccagcatcag gcttctttcc ctactgttcg ttcaccaacg gcgagacttc cccaactgtg       660
     tccatggcag aattagaaca ccttgcacag aatatatcta aatcgcatct ggaaacctgc       720
     caatacttga gagaagagct ccagcagata acgtggcaga cctttttaca ggaagaaatt       780
     gagaactatc aaaacaagca gcgggaggtg atgtggcaat tgtgtgccat caaaattaca       840
     gaagctatac agtatgtggt ggagtttgcc aaacgcatcg atggatttat ggaactgtgt       900
     caaaatgatc aaattgtgct tctaaaagca ggttctctag aggtggtgtt tatcagagtg       960
     tgccgtgcct ttgactctca gaacaacacc gtgtactttg atgggaagta tgccagcccc      1020
     gacgtcttca aatccttagg ttgtgaagac tttattagct ttgtgtttga atttggaaag      1080
     agtttatgtt ctatgcacct gactgaagat gaaattgcat tattttctgc atttgtactg      1140
     atgtcagcag atcgctcatg gctgcaagaa aaggtaaaaa ttgaaaaact gcaacagaaa      1200
     attcagctag ctcttcaaca cgtcctacag aagaatcacc gagaagatgg aatgctaaca      1260
     aagttaatat gcaaggtgtc tacattaaga gccttatgtg gacgacatac agaaaagcta      1320
     atggcattta aagcaatata cccagacatt gtgcgacttc attttcctcc attatacaag      1380
     gagttgttca cttcagaatt tgagccagca atgcaaattg atgggtaaat gttatcacct      1440
     aagcacttct agaatgtctg aagtacaaac atg                                   1473
//