Dbfetch

ID   L11625; SV 1; linear; mRNA; STD; MUS; 1951 BP.
XX
AC   L11625;
XX
DT   24-JAN-1996 (Rel. 46, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus receptor tyrosine kinase mRNA, 3' end.
XX
KW   receptor protein-tyrosine kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1951
RA   Dowds C.A., Burks D.J., Saling P.M.;
RT   "A cDNA encoding part of a novel putative receptor tyrosine kinase";
RL   Unpublished.
XX
DR   MD5; d3e251e8fa67b8c894fc44d6dd591644.
DR   Ensembl-Gn; ENSMUSG00000014361; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026475; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026439; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026414; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026451; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026896; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025655; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026308; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026413; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026951; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025729; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000014505; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0057561; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0057594; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0057542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0057533; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057224; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058005; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0057466; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0057196; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0057293; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0057270; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0057428; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057240; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058171; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057053; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0056524; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1951
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1536
FT                   /codon_start=1
FT                   /product="receptor protein-tyrosine kinase"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60805"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96965"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60805"
FT                   /protein_id="AAA85355.1"
FT                   /translation="NSARAEHSKVDYAPSSTPAPGNTDSMFIILGCFCGFILIGLILCV
FT                   SLALRRRVQETKFGGAFSEEDSQLVVNYRAKKSFCRRAIELTLQSLGVSEELQNKLEDV
FT                   VIDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAA
FT                   CMKDFNHPNVIRLLGVCIELSSQGIPKPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQ
FT                   TLLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQG
FT                   RIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHG
FT                   HRLKQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESIIYINT
FT                   QLLESCEGIANGPSLTGLDMNIDPDSIIASCTPGAAVSVVTAEVHENNLREERYILNGG
FT                   NEEWEDVSSTPFAAVTPEKDGVLPETDSPKMASPGLTIVHYPWGAHHQMNFYL"
XX
SQ   Sequence 1951 BP; 531 A; 460 C; 495 G; 465 T; 0 other;
     aattcggcac gagctgaaca cagtaaggta gattacgcac cctcgtcaac cccagcccct        60
     ggcaacaccg actctatgtt catcatcctc ggctgcttct gtggattcat tttaatcggg       120
     ttaattttgt gtgtttctct ggccctcaga aggagagtcc aggaaacaaa gtttggggga       180
     gcattctctg aggaggattc ccaactggtc gtaaattata gagcgaagaa gtccttctgc       240
     cggcgagcca tcgagcttac cttgcagagc ctgggagtga gcgaggagct gcagaataag       300
     ctagaagatg ttgtgattga cagaaacctt ctggttctcg gcaaagttct gggtgaagga       360
     gagtttgggt ctgtaatgga aggaaatctg aagcaggaag atgggacttc tcagaaggtg       420
     gcagtgaaga ccatgaagtt ggacaacttt tctcaacggg agatcgagga gtttctcagc       480
     gaagcagcat gcatgaaaga cttcaaccac ccaaatgtca tccgacttct aggcgtgtgt       540
     atagaactga gctctcaagg catcccgaag cccatggtga ttttaccctt catgaaatac       600
     ggagacctcc acaccttcct gttatattcc cgattaaaca caggacccaa gtacattcac       660
     ctgcagacac tgctgaagtt catgatggac attgcccagg gaatggagta tctgagcaac       720
     aggaattttc ttcataggga tttggcagct cgaaactgca tgttgcggga tgacatgact       780
     gtctgcgtgg cagactttgg cctctcaaag aagatttaca gtggtgatta ttaccgccaa       840
     ggccgcattg ccaaaatgcc tgtgaagtgg atcgccatcg agagcctggc agaccgagtc       900
     tacacaagca aaagtgacgt gtgggctttt ggcgtgacca tgtgggaaat aacaacacgg       960
     ggaatgactc cctatcccgg agttcagaac catgagatgt acgactacct tctccacggc      1020
     cacaggctga agcagcctga ggactgcctg gatgaactgt atgacatcat gtactcttgc      1080
     tggagtgctg atcccttgga tcgacccacc ttctctgtgt tgaggctgca gctggaaaag      1140
     ctctccgaga gtttgcctga tgcgcaggac aaagaatcca tcatctacat caatacccag      1200
     ttgctagaga gctgcgaggg catagccaat gggccctcac tcacggggct agacatgaac      1260
     attgaccctg actccatcat tgcctcttgc acaccaggcg ctgccgtcag cgtggtcacg      1320
     gcagaagttc acgagaacaa ccttcgtgag gaaagataca tcttgaatgg gggcaatgag      1380
     gaatgggaag atgtgtcctc cactcctttt gctgcagtca cacctgaaaa ggatggtgtc      1440
     ttaccggaga cagactcacc aaaaatggcg tctcctggtc tcaccatagt acactaccct      1500
     tggggagccc atcaccagat gaacttttat ttgtagatga ctccttggaa gactctgaag      1560
     ttctgatgtg aagccagctg agaggaggca tgagagaacc aagcaaatac agcttcctgg      1620
     gatctggtgg tcttagatac tttgttattg ctctgataaa acatcatgac caaggcaatc      1680
     ttcaagagaa agtgtttaac taggtttact gtttcagggg ttagagtcta tgattgcaga      1740
     aggaagttat gatggcagga acagctgagt gcttatatct ttaagagcaa gcaggagaca      1800
     gagagcactc tggaaatggc acctatcttt tgaaacctca aagcctgctc ccagtgacaa      1860
     aagtccttca acaggccata cctcctaatc cttcccaaac aattccacca actggagacc      1920
     aaacattcaa atgtatgcgc gtattggggc c                                     1951
//