spacer

EBI Dbfetch

ID   L11064; SV 1; linear; mRNA; STD; MUS; 2272 BP.
XX
AC   L11064;
XX
DT   27-AUG-1993 (Rel. 36, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mouse delta opioid receptor mRNA, complete cds.
XX
KW   delta opioid receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2272
RX   DOI; 10.1073/pnas.90.14.6736.
RX   PUBMED; 8393575.
RA   Yasuda K., Raynor K., Kong H., Breder C.D., Takeda J., Reisine T.,
RA   Bell G.I.;
RT   "Cloning and functional comparison of kappa and delta opioid receptors from
RT   mouse brain";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(14):6736-6740(1993).
XX
DR   Ensembl-Gn; ENSMUSG00000050511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056336; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2272
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="Clontech #ML1036a"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             12..1130
FT                   /codon_start=1
FT                   /product="delta opioid receptor"
FT                   /db_xref="GOA:P32300"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="PDB:4EJ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32300"
FT                   /protein_id="AAA37520.1"
FT                   /translation="MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASS
FT                   LALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPF
FT                   QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPA
FT                   KAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAF
FT                   VVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFV
FT                   IVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ
FT                   EPGSLRRPRQATTRERVTACTPSDGPGGGAAA"
XX
SQ   Sequence 2272 BP; 485 A; 665 C; 650 G; 472 T; 0 other;
     cacgcggcgc catggagctg gtgccctctg cccgtgcgga gctgcagtcc tcgcccctcg        60
     tcaacctctc ggacgccttt cccagcgcct tccccagcgc gggcgccaat gcgtcggggt       120
     cgccgggagc ccgtagtgcc tcgtccctcg ccctagccat cgccatcacc gcgctctact       180
     cggctgtgtg cgcagtgggg cttctgggca acgtgctcgt catgtttggc atcgtccggt       240
     acaccaaatt gaagaccgcc accaacatct acatcttcaa tctggctttg gctgatgcgc       300
     tggccaccag cacgctgccc ttccagagcg ccaagtactt gatggaaacg tggccgtttg       360
     gcgagctgct gtgcaaggct gtgctctcca ttgactacta caacatgttc actagcatct       420
     tcaccctcac catgatgagc gtggaccgct acattgctgt ctgccatcct gtcaaagccc       480
     tggacttccg gacaccagcc aaggccaagc tgatcaatat atgcatctgg gtcttggctt       540
     caggtgtcgg ggtccccatc atggtcatgg cagtgaccca accccgggat ggtgcagtgg       600
     tatgcatgct ccagttcccc agtcccagct ggtactggga cactgtgacc aagatctgcg       660
     tgttcctctt tgccttcgtg gtgccgatcc tcatcatcac ggtgtgctat ggcctcatgc       720
     tactgcgcct gcgcagcgtg cgtctgctgt ccggttccaa ggagaaggac cgcagcctgc       780
     ggcgcatcac gcgcatggtg ctggtggtgg tgggcgcctt cgtggtgtgc tgggcgccca       840
     tccacatctt cgtcatcgtc tggacgctgg tggacatcaa tcggcgcgac ccacttgtgg       900
     tggccgcact gcacctgtgc attgcgctgg gctacgccaa cagcagcctc aacccggttc       960
     tctacgcctt cctggacgag aacttcaagc gctgcttccg ccagctctgt cgcacgccct      1020
     gcggccgcca agaacccggc agtctccgtc gtccccgcca ggccaccacg cgtgagcgtg      1080
     tcactgcctg caccccctcc gacggcccgg gcggtggcgc tgccgcctga cctacccgac      1140
     cttcccctta aacgcccctc ccaagtgaag tgatccagag gccacaccga gctccctggg      1200
     aggctgtggc caccaccagg acagctagaa ttgggcctgc acagagggga ggcctcctgt      1260
     ggggacgggg cctgagggat caaaggctcc aggttggaac ggtgggggtg aggaagcaga      1320
     gctggtgatt cctaaactgt atccattagt aaggcctctc caatgggaca gagcctccgc      1380
     cttgagataa catcgggttc tggccaaaaa gaacaccagc tccagtccaa gacccaagga      1440
     ttccagctcc aggaaccagg aggggtcgat gatttggttt ggctgagagt cccagcattt      1500
     gtgttatggg gaggatctct catcttagag aagataaggg gacagggcat tcaggcaagg      1560
     cagcttgggg tttggtcagg agataagcgc ccccttccct tggggggagg ataagtgggg      1620
     gatggtcaac gttggagaag agtcaaagtt ctcaccacct ttctaactac tcagctaaac      1680
     tcgttgaggc tagggcaacg tgacttctct gtagagagga tacaagccgg gcctgatggg      1740
     gcaggctgtg taatcccagt catagtggag gctgaggctg gaaaattaag gaccaacagc      1800
     ctgggcaatt tagtgtctca aaataaaatg taaagagggc tgggaatgta gctcagtggt      1860
     agggtgtttg tgtgaggctc tgggatcaat aagacaaaac aaccaaccaa ccaaaaacct      1920
     tccaaacaac aaaaccaacc ctcaaaccaa aaaactatgt gggtgtctct gagtctggtt      1980
     tgaagagaac ccgcagccct gtatccctgt ggggctgtgg acagtgggca gaagcagagg      2040
     ctccctggat cctgaacaag ggccccaaaa gcaagttcta aagggacccc tgaaaccgag      2100
     taagcctttg tgtcaagaag tgggagtaga accagaaagg tggctgagtg attaagggca      2160
     cgtgactctc ttgcagagga cataggttcg attcccagca cccacatagt ggctcacagc      2220
     catctgtaac cccagtcgca gtcaatctaa tgctttccaa caactgtggg ca              2272
//


spacer
spacer