spacer

EBI Dbfetch

ID   L10402; SV 1; linear; genomic DNA; STD; HUM; 228 BP.
XX
AC   L10402;
XX
DT   10-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC HLA-DRB1 (CAYAPA) gene, partial cds.
XX
KW   cell surface glycoprotein; lymphocyte antigen-DRB1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-228
RX   PUBMED; 8023844.
RA   Titus-Trachtenberg E.A., Rickards O., De Stefano G.F., Erlich H.A.;
RT   "Analysis of HLA class II haplotypes in the Cayapa Indians of Ecuador: a
RT   novel DRB1 allele reveals evidence for convergent evolution and balancing
RT   selection at position 86";
RL   Am. J. Hum. Genet. 55(1):160-167(1994).
XX
DR   MD5; db30b3a36312547d0262a5ad6bf93f18.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   EuropePMC; PMC1918223; 8023844.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*08042-DQA*04/06-DQB*0402"
FT                   /dev_stage="adult"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>228
FT                   /codon_start=1
FT                   /product="MHC HLA-DRB1"
FT                   /db_xref="GOA:Q30134"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*08:04:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30134"
FT                   /protein_id="AAA51400.1"
FT                   /translation="FNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWN
FT                   SQKDFLEDRRALVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 228 BP; 51 A; 54 C; 84 G; 39 T; 0 other;
     ttcaatggga cggagcgggt gcggttcctg gacagatact tctataacca agaggagtac        60
     gtgcgcttcg acagcgacgt gggggagtac cgggcggtga cggagctggg gcggcctgat       120
     gccgagtact ggaacagcca gaaggacttc ctggaagaca ggcgggccct ggtggacacc       180
     tactgcagac acaactacgg ggttgttgag agcttcacag tgcagcgg                    228
//


spacer
spacer