Dbfetch

ID   L08850; SV 1; linear; mRNA; STD; HUM; 1549 BP.
XX
AC   L08850;
XX
DT   01-JAN-1994 (Rel. 38, Created)
DT   30-JUN-1999 (Rel. 60, Last updated, Version 3)
XX
DE   Human AD amyloid mRNA, complete cds.
XX
KW   AD amyloid; Alzheimer's disease; amyloid; NACP.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1549
RX   DOI; 10.1073/pnas.90.23.11282.
RX   PUBMED; 8248242.
RA   Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M.,
RA   Otero D.A., Kondo J., Ihara Y., Saitoh T.;
RT   "Molecular cloning of cDNA encoding an unrecognized component of amyloid in
RT   Alzheimer disease";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(23):11282-11286(1993).
XX
DR   MD5; 4caa860b59eb93287cb04c9c9a45d530.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
DR   Ensembl-Tr; ENST00000618500; homo_sapiens.
DR   EuropePMC; PMC2753269; 19525899.
DR   EuropePMC; PMC3076891; 21338582.
DR   EuropePMC; PMC3105182; 21565333.
DR   EuropePMC; PMC47966; 8248242.
DR   EuropePMC; PMC4962062; 23175842.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1549
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="ATCC 37432 of A. Lazzarini"
FT                   /db_xref="taxon:9606"
FT   regulatory      35..473
FT                   /regulatory_class="terminator"
FT   CDS             53..475
FT                   /codon_start=1
FT                   /standard_name="NACP"
FT                   /product="AD amyloid"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000191921.14"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2N0A"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /db_xref="PDB:4R0U"
FT                   /db_xref="PDB:4R0W"
FT                   /db_xref="PDB:4RIK"
FT                   /db_xref="PDB:4RIL"
FT                   /db_xref="PDB:4ZNN"
FT                   /db_xref="PDB:5CRW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="AAA16117.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
FT   regulatory      1023..1028
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1023
FT   regulatory      1079..1084
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1529..1534
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1549
XX
SQ   Sequence 1549 BP; 471 A; 248 C; 342 G; 488 T; 0 other;
     gctctcggag tggccattcg acgacagtgt ggtgtaaagg aattcattag ccatggatgt        60
     attcatgaaa ggactttcaa aggccaagga gggagttgtg gctgctgctg agaaaaccaa       120
     acagggtgtg gcagaagcag caggaaagac aaaagagggt gttctctatg taggctccaa       180
     aaccaaggag ggagtggtgc atggtgtggc aacagtggct gagaagacca aagagcaagt       240
     gacaaatgtt ggaggagcag tggtgacggg tgtgacagca gtagcccaga agacagtgga       300
     gggagcaggg agcattgcag cagccactgg ctttgtcaaa aaggaccagt tgggcaagaa       360
     tgaagaagga gccccacagg aaggaattct ggaagatatg cctgtggatc ctgacaatga       420
     ggcttatgaa atgccttctg aggaagggta tcaagactac gaacctgaag cctaagaaat       480
     atctttgctc ccagtttctt gagatctgct gacagatgtt ccatcctgta caagtgctca       540
     gttccaatgt gcccagtcat gacatttctc aaagttttta cagtgtatct cgaagtcttc       600
     catcagcagt gattgaagta tctgtacctg cccccactca gcatttcggt gcttcccttt       660
     cactgaagtg aatacatggt agcagggtct ttgtgtgctg tggattttgt ggcttcaatc       720
     tacgatgtta aaacaaatta aaaacaccta agtgactacc acttatttct aaatcctcac       780
     tatttttttg ttgctgttgt tcagaagttg ttagtgattt gctatcatat attataagat       840
     ttttaggtgt cttttaatga tactgtctaa gaataatgac gtattgtgaa atttgttaat       900
     atatataata cttaaaaata tgtgagcatg aaactatgca cctataaata ctaaatatga       960
     aattttacca ttttgcgatg tgttttattc acttgtgttt gtatataaat ggtgagaatt      1020
     aaaataaaac gttatctcat tgcaaaaata ttttattttt atcccatctc actttaataa      1080
     taaaaatcat gcttataagc aacatgaatt aagaactgac acaaaggaca aaaatataaa      1140
     gttattaata gccatttgaa gaaggaggaa ttttagaaga ggtagagaaa atggaacatt      1200
     aaccctacac tcggaattcc ctgaagcaac actgccagaa gtgtgttttg gtatgcactg      1260
     gttccttaag tggctgtgat taattattga aagtggggtg ttgaagaccc caactactat      1320
     tgtagagtgg tctatttctc ccttcaatcc tgtcaatgtt tgctttatgt attttgggga      1380
     actgttgttt gatgtgtatg tgtttataat tgttatacat ttttaattga gccttttatt      1440
     aacatatatt gttatttttg tctcgaaata attttttagt taaaatctat tttgtctgat      1500
     attggtgtga atgctgtacc tttctgacaa taaataatat tcgaccatg                  1549
//