Dbfetch

ID   L08235; SV 1; linear; mRNA; STD; MUS; 1644 BP.
XX
AC   L08235;
XX
DT   05-OCT-1993 (Rel. 37, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus clusterin mRNA, complete cds.
XX
KW   clusterin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1644
RX   DOI; 10.1083/jcb.122.5.1119.
RX   PUBMED; 8354695.
RA   French L.L., Chonn A.A., Tschopp J.J.;
RT   "Murine clusterin: molecular cloning and mRNA localization of a gene
RT   associated with epithelial differentiation processes during embryogenesis";
RL   J. Cell Biol. 122(5):1119-1130(1993).
XX
DR   MD5; 95bb46407085aad19f2bf46a8b701d7b.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021423; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021892; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021197; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021320; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021299; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020800; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039895; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039865; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039822; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039869; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040343; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039610; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039523; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039667; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039634; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039628; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0038997; mus_musculus_wsbeij.
DR   EuropePMC; PMC313062; 11116095.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1644
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_lib="Stratagene heart"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     64..126
FT   CDS             64..1410
FT                   /codon_start=1
FT                   /product="clusterin"
FT                   /db_xref="GOA:Q06890"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="InterPro:IPR033986"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06890"
FT                   /protein_id="AAA37422.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQY
FT                   KELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
FT   mat_peptide     127..1407
FT                   /product="clusterin"
FT                   /note="'processed postranslationally after residue 205
FT                   (Arg)'"
FT   regulatory      1616..1621
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1642
XX
SQ   Sequence 1644 BP; 406 A; 474 C; 431 G; 333 T; 0 other;
     cgctcctcct ggtgacgcgg gtcaagccgc agaccggact ccagattcca aggaggccac        60
     gccatgaaga ttctcctgct gtgcgtggca ctgctgctga tctgggacaa tggcatggtc       120
     ctgggagagc aggaggtctc tgacaatgag ctccaagaac tgtccactca agggagtagg       180
     tatattaata aggagattca gaacgccgtc cagggagtga agcacataaa aactctcata       240
     gaaaaaacca acgcagagcg caagtccctg ctcaacagtt tagaggaagc caagaagaag       300
     aaagaggatg ctctggagga cactagggat tctgaaatga agctgaaggc attcccggaa       360
     gtgtgtaacg agaccatgat ggccctctgg gaggagtgca agccctgcct gaagcatacc       420
     tgcatgaagt tctatgcacg tgtctgcagg agcggctcag ggctggtcgg ccagcagcta       480
     gaggagtttc taaaccagag ctcacccttc tacttctgga tgaacggcga ccgcatcgac       540
     tccctgctgg agagtgaccg gcagcagagc caagtcctgg atgccatgca ggacagcttt       600
     gctcgggcat ctggcatcat agacacgctc tttcaggacc ggttcttcgc ccgtgagctt       660
     catgaccccc actacttctc ccccatcggc ttcccacaca agaggcctca tttcttatat       720
     cccaagtccc gcttggtccg cagcctcatg tctccctccc actatgggcc tccgagcttc       780
     cacaacatgt tccagccttt ctttgagatg atccaccagg ctcaacaggc catggatgtc       840
     cagctccaca gcccagcctt ccagttccca gacgtggatt tcttaagaga aggtgaagat       900
     gaccgcactg tgtgcaagga gatccgccgc aactccacag gatgcctgaa gatgaagggc       960
     cagtgtgaaa agtgccagga gatcttgtct gtggactgtt caaccaacaa tcctgcccag      1020
     gctaacctgc gccaggagct gaacgactcg ctccaggtgg ccgagaggct gacagagcag      1080
     tacaaggagc tgctgcagtc cttccagtcg aagatgctca acacctcatc cctgctggag      1140
     cagctgaacg accagttcaa ctgggtgtcc cagctggcta acctcacaca gggcgaagac      1200
     aagtactacc ttcgggtctc caccgtgacc acccattcct ctgactcaga ggtcccctcc      1260
     cgtgtcactg aggtggtggt gaagctgttt gactctgacc ccatcacagt ggtgttacca      1320
     gaagaagtct ctaaggataa ccctaagttt atggacacag tggcggagaa ggcgctacag      1380
     gaataccgca ggaaaagccg tgcggaatga gatagaagca tcaccttcct atatgtagga      1440
     gtgtctggga gggaatctcc cagctccccg aggtggctgc agacccctag agaactccac      1500
     atgtctccag gcgagtaggc ctcacccaag cagcctgccc ttcctctgga ttctgtacac      1560
     taatgcctgc acttgctgct ctcgggaaga actgattccc ccacgcaact aatccaataa      1620
     aagccgcctt gcgatacggt gtaa                                             1644
//