spacer

EBI Dbfetch

ID   L06322; SV 1; linear; mRNA; STD; MUS; 2219 BP.
XX
AC   L06322;
XX
DT   24-DEC-1992 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus delta-opioid receptor mRNA, complete cds.
XX
KW   delta-opioid receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2219
RX   DOI; 10.1073/pnas.89.24.12048.
RX   PUBMED; 1334555.
RA   Kieffer B.L., Befort K., Gaveriaux-Ruff C., Hirth C.G.;
RT   "The delta-opioid receptor: isolation of a cDNA by expression cloning and
RT   pharmacological characterization";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(24):12048-12052(1992).
XX
DR   MD5; 12c706194b7fbd31701d4073a1c84dae.
DR   Ensembl-Gn; ENSMUSG00000050511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056336; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2219
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             59..1177
FT                   /codon_start=1
FT                   /product="delta-opioid receptor"
FT                   /db_xref="GOA:P32300"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="PDB:4EJ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32300"
FT                   /protein_id="AAA37522.1"
FT                   /translation="MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASS
FT                   LALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPF
FT                   QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPA
FT                   KAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAF
FT                   VVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFV
FT                   IVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ
FT                   EPGSLRRPRQATTRERVTACTPSDGPGGGAAA"
FT   regulatory      1883..1888
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2219 BP; 460 A; 649 C; 650 G; 460 T; 0 other;
     ctctaaaggc tgggtccctg cgcccagggc gcacggtgga gacggacacg gcggcgccat        60
     ggagctggtg ccctctgccc gtgcggagct gcagtcctcg cccctcgtca acctctcgga       120
     cgcctttccc agcgccttcc ccagcgcggg cgccaatgcg tcggggtcgc cgggagcccg       180
     tagtgcctcg tccctcgccc tagccatcgc catcaccgcg ctctactcgg ctgtgtgcgc       240
     agtggggctt ctgggcaacg tgctcgtcat gtttggcatc gtccggtaca ccaaattgaa       300
     gaccgccacc aacatctaca tcttcaatct ggctttggct gatgcgctgg ccaccagcac       360
     gctgcccttc cagagcgcca agtacttgat ggaaacgtgg ccgtttggcg agctgctgtg       420
     caaggctgtg ctctccattg actactacaa catgttcact agcatcttca ccctcaccat       480
     gatgagcgtg gaccgctaca ttgctgtctg ccatcctgtc aaagccctgg acttccggac       540
     accagccaag gccaagctga tcaatatatg catctgggtc ttggcttcag gtgtcggggt       600
     ccccatcatg gtcatggcag tgacccaacc ccgggatggt gcagtggtat gcatgctcca       660
     gttccccagt cccagctggt actgggacac tgtgaccaag atctgcgtgt tcctctttgc       720
     cttcgtggtg ccgatcctca tcatcacggt gtgctatggc ctcatgctac tgcgcctgcg       780
     cagcgtgcgt ctgctgtccg gttccaagga gaaggaccgc agcctgcggc gcatcacgcg       840
     catggtgctg gtggtggtgg gcgccttcgt ggtgtgctgg gcgcccatcc acatcttcgt       900
     catcgtctgg acgctggtgg acatcaatcg gcgcgaccca cttgtggtgg ccgcactgca       960
     cctgtgcatt gcgctgggct acgccaacag cagcctcaac ccggttctct acgccttcct      1020
     ggacgagaac ttcaagcgct gcttccgcca gctctgtcgc acgccctgcg gccgccaaga      1080
     acccggcagt ctccgtcgtc cccgccaggc caccacgcgt gagcgtgtca ctgcctgcac      1140
     cccctccgac ggcccgggcg gtggcgctgc cgcctgacct acccgacctt ccccttaaac      1200
     gcccctccca agtgaagtga tccagaggcc acaccgagct ccctgggagg ctgtggccac      1260
     caccaggaca gctagaattg ggcctgcaca gaggggaggc ctcctgtggg gacggggcct      1320
     gagggatcaa aggctccagg ttggaacggt gggggtgagg aagcagagct ggtgattcct      1380
     aaactgtatc cattagtaag gcctctccaa tgggacagag cctccgcctt gagataacat      1440
     cgggttctgg cctttttgaa cacccagctc cagtccaaga cccaaggatt ccagctccag      1500
     gaaccaggag gggcagtgat ggggtcgatg atttggtttg gctgagagtc ccagcatttg      1560
     tgttatgggg aggatctctc atcttagaga agataagggg acagggcatt caggcaaggc      1620
     agcttggggt ttggtcagga gataagcgcc cccttccctt ggggggagga taagtggggg      1680
     atggtcaacg ttggagaaga gtcaaagttc tcaccacctt tctaactact cagctaaact      1740
     cgttgaggct agggccaacg tgacttctct gtagagagga tacaagccgg gcctgatggg      1800
     gcaggcctgt gtaatcccag tcatagtgga ggctgaggct ggaaaattaa ggaccaacag      1860
     cctgggcaat ttagtgtctc aaaataaaat gtaaagaggg ctgggaatgt agctcagtgg      1920
     tagggtgttt gtgtgaggct ctgggatcaa taagacaaaa caaccaacca accaaaaacc      1980
     ttccaaacaa caaaaccaac cctcaaacca aaaaactatg tgggtgtctc tgagtctggt      2040
     ttgaagagaa cccgcagccc tgtatccctg tggggctgtg gacagtgggc agaagcagag      2100
     gctccctgga tcctgaacaa gggccccaaa agcaagttct aaagggaccc ctgaaaccga      2160
     gtaagccttt gtgtcaagaa gtgggagtac aaccagaaag gtggctgagt gctttagag       2219
//


spacer
spacer