Dbfetch

ID   L06233; SV 1; linear; mRNA; STD; MUS; 928 BP.
XX
AC   L06233;
XX
DT   02-JAN-1993 (Rel. 34, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 12)
XX
DE   Mus musculus dihydropyridine sensitive cardiac calcium channel mRNA,
DE   partial cds.
XX
KW   cardiac calcium channel; dihydropyridine-sensitive calcium channel;
KW   voltage-gated calcium channel.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 1281468.
RA   Chaudhari N.;
RT   "A single nucleotide deletion in the skeletal muscle-specific calcium
RT   channel transcript of muscular dysgenesis (mdg) mice";
RL   J Biol Chem 267(36):25636-25639(1992).
XX
DR   MD5; 6b9bf2020c86346b71392701b381d649.
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031189; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031158; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031089; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031627; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030276; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030852; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031008; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030960; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031087; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031656; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029991; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030359; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112825; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079653; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079671; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077610; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080144; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079884; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079251; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079407; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079290; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079443; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079298; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080396; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079313; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078403; mus_musculus_wsbeij.
XX
CC   Reference [Dev. Biol. (1993) In press] reports features only.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..928
FT                   /organism="Mus musculus"
FT                   /strain="129Re/J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="immature"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>928
FT                   /codon_start=2
FT                   /standard_name="cardiac calcium channel"
FT                   /product="dihydropyridine sensitive calcium channel"
FT                   /function="voltage gated ion channel"
FT                   /note="partial cDNA encoding loop between homologous repeat
FT                   II and III and transmembrane helices 1-5 of repeat III;
FT                   putative"
FT                   /db_xref="GOA:Q01815"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005451"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR031649"
FT                   /db_xref="InterPro:IPR031688"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01815"
FT                   /citation=[1]
FT                   /protein_id="AAA37351.1"
FT                   /translation="LTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIEL
FT                   KSITADGESPPTTKINMDDLQPSENEDKSPTPTQTTAGEEDEEEPEMPVGPRPRPLSEL
FT                   HLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQ
FT                   HTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLIS
FT                   FGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFM
FT                   FACIGVQLFKGKLYTCSDSSKQTEAECK"
XX
SQ   Sequence 928 BP; 242 A; 253 C; 231 G; 202 T; 0 other;
     cctgacctca gcccaaaagg aggaggaaga agagaaggag aggaagaagc tggccaggac        60
     tgccagccca gaaaagaaac aggaggtgat ggagaagcca gccgtggagg agagcaaaga       120
     ggagaaaatt gaactgaaat ccattacagc cgatggagaa tccccaccca ctaccaagat       180
     caacatggat gacctccagc ccagtgaaaa cgaggataag agtcccactc caacccagac       240
     tactgcaggg gaagaggatg aagaggagcc agagatgcct gtggggccac gcccccggcc       300
     cctgtctgag ctgcacctta aggaaaaggc agttcccatg ccggaagcca gtgcattttt       360
     catcttcagc ccaaacaaca ggttccgcct gcagtgccac cgtattgtca atgacacgat       420
     cttcaccaac ctcatcctct tcttcattct gctcagcagc atctctctgg ctgctgagga       480
     ccccgtccag cacacctcct tcaggaacca tattctgttt tattttgaca ttgtttttac       540
     caccattttc accattgaaa ttgctctaaa gatgactgct tacggggctt tcctgcacaa       600
     gggctctttc tgccgaaact acttcaatat cctggacctg ctggtggtta gcgtgtccct       660
     catctccttt ggcatccagt ccagcgcgat caacgttgtg aagattttac gagtgctgcg       720
     agtcctcaga cccctgaggg ccatcaacag ggccaagggg ctaaagcatg tggttcagtg       780
     cgtgtttgtg gccatccgga ccatcgggaa catcgtaatt gtcaccactc tgctgcagtt       840
     catgttcgcc tgcattgggg tccagctctt caagggaaag ctctatacct gttcggatag       900
     ttctaaacag acggaggcag aatgcaag                                          928
//