spacer

EBI Dbfetch

ID   L06047; SV 1; linear; mRNA; STD; MUS; 926 BP.
XX
AC   L06047;
XX
DT   13-NOV-1992 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus glutathione transferase mRNA, complete cds.
XX
KW   glutathione transferase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-926
RX   DOI; 10.1016/0014-5793(92)81438-R.
RX   PUBMED; 1426286.
RA   Zimniak P., Eckles M.A., Saxena M., Awasthi Y.C.;
RT   "A subgroup of class alpha glutathione S-transferases. Cloning of cDNA for
RT   mouse lung glutathione S-transferase GST 5.7";
RL   FEBS Lett. 313(2):173-176(1992).
XX
DR   MD5; 106b2017147b57542d8bbfdac6240768.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..926
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             72..740
FT                   /codon_start=1
FT                   /product="glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="AAA37754.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRIVLKF
FT                   "
FT   polyA_signal    889..895
FT                   /note="rare type with double T; putative"
XX
SQ   Sequence 926 BP; 283 A; 213 C; 231 G; 199 T; 0 other;
     ggaaccgctt ctttctcgag tgcctggaga caaaaatccc acaagaataa ggaagctctg        60
     aagcaggagt catggcagcc aaacctaagc tctactactt taatggcagg ggacggatgg       120
     agtcgatccg ctggctgctg gctgcggctg gagtggagtt tgaggaagaa tttcttgaga       180
     caagggaaca gtatgagaag atgcaaaagg atggacacct gcttttcggc caagtaccct       240
     tggttgaaat cgatgggatg atgctgacac agaccagggc catcctcagc tacctcgctg       300
     ccaagtacaa cttgtatggg aaggacctga aggagagagt caggattgac atgtatgcag       360
     atggcaccca ggacctgatg atgatgattg ccgtggctcc atttaaaacc cccaaggaaa       420
     aagaggagag ctatgatttg atactgtcaa gagctaaaac ccgttacttc ccagtgtttg       480
     aaaagatttt aaaagaccac ggagaggctt ttctcgttgg caaccagctc agttgggcag       540
     acatccagct cctagaagcc attttgatgg tggaagaact cagtgcccct gtactgtccg       600
     acttccctct gctgcaggca tttaagacaa gaatcagcaa cattcctaca attaagaagt       660
     tcctgcaacc cggaagtcag aggaagcctc ctccagatgg cccctatgtt gaggtggtca       720
     ggattgtcct gaagttctag tgcagcgtgc tttaaggtgg cacccacaag gttccaattg       780
     cagtgtcacc acaggccagc tgcagagcat tccagaagca aggtatatag atcccaggag       840
     tcaagctctt caaacaacaa aaccactctg cccacaatga caaatgccaa ttaaatacag       900
     tggaaaacta aaaaaaaaaa aaaaaa                                            926
//


spacer
spacer