Dbfetch

ID   L05670; SV 1; linear; mRNA; STD; MUS; 1669 BP.
XX
AC   L05670;
XX
DT   13-NOV-1992 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus alpha-clustrin and beta-clustrin mRNA, complete cds.
XX
KW   alpha-clustrin; beta-clustrin; secreted protein; sulfated glycoprotein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1669
RA   Hodgdon B.A., Min B.H., Yan H.G., Farris J.A., Foster D.N., Strauch A.R.;
RT   "Secretion of sulfated glycoprotein (clustrin) accompanies
RT   cytodifferentiation and structural remodeling of mouse BC3H1 myogenic
RT   cells";
RL   Unpublished.
XX
DR   MD5; 073365f5329a67d1dd38cd40ac7d1758.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021423; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021892; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021197; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021320; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021299; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020800; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039895; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039865; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039822; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039869; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040343; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039610; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039523; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039667; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039634; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039628; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0038997; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1669
FT                   /organism="Mus musculus"
FT                   /strain="C3H"
FT                   /mol_type="mRNA"
FT                   /cell_line="BC3H1"
FT                   /cell_type="myogenic"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..91
FT   sig_peptide     92..154
FT                   /note="post-translational modification."
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             92..1438
FT                   /codon_start=1
FT                   /product="clustrin"
FT                   /note="post-translational modification; putative"
FT                   /db_xref="GOA:Q06890"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06890"
FT                   /protein_id="AAA37284.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAETVTEQY
FT                   KELLQSFQSNMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
FT   mat_peptide     155..769
FT                   /product="alpha-clustrin"
FT                   /note="post-translational modification"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   mat_peptide     770..1435
FT                   /product="beta-clustrin"
FT                   /note="post-translational modification; putative"
FT   3'UTR           1439..1669
FT   regulatory      1644..1649
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1669
XX
SQ   Sequence 1669 BP; 411 A; 487 C; 435 G; 336 T; 0 other;
     cgcttccccg gtgctcacca cccgcgtcac caggaggagc gcactggagc caagccgcag        60
     accggactcc agattccaag gaggccacgc catgaagatt ctcctgctgt gcgtggcact       120
     gctgctgatc tgggacaatg gcatggtcct gggagagcag gaggtctctg acaatgagct       180
     ccaagaactg tccactcaag ggagtaggta tattaataag gagattcaga acgccgtcca       240
     gggagtgaag cacataaaaa ctctcataga aaaaaccaac gcagagcgca agtccttgct       300
     caacagttta gaggaagcca agaagaagaa agaggatgct ctggaggaca ctagggattc       360
     tgaaatgaag ctgaaggcat tcccggaagt gtgtaacgag accatgatgg ccctctggga       420
     ggagtgcaag ccctgcctga agcatacctg catgaagttc tatgcacgtg tctgcaggag       480
     cggctcaggg ctggtcggcc agcagctaga ggagtttcta aaccagagct cacccttcta       540
     cttctggatg aacggcgacc gcatcgactc cctgctggag agtgaccggc agcagagcca       600
     agtcctggat gccatgcagg acagctttgc tcgggcatct ggcatcatag acacgctctt       660
     tcaggaccgg ttcttcgccc gtgagcttca tgacccccac tacttctccc ccatcggctt       720
     cccacacaag aggcctcatt tcttatatcc caagtcccgc ttggtccgca gcctcatgtc       780
     tccctcccac tatgggcctc cgagcttcca caacatgttc cagcctttct ttgagatgat       840
     ccaccaggct caacaggcca tggatgtcca gctccacagc ccagccttcc agttcccaga       900
     cgttgatttc ttaagagaag gtgaagatga ccgcactgtg tgcaaggaga tccgccgcaa       960
     ctccacagga tgcctgaaga tgaagggcca gtgtgaaaag tgccaggaga tcttgtctgt      1020
     ggactgttca accaacaatc ctgcccaggc taacctgcgc caggagctga acgactcgct      1080
     ccaggtggcc gagacggtga cagagcagta caaggagctg ctgcagtcct tccagtcgaa      1140
     catgctcaac acctcatccc tgctggagca gctgaacgac cagttcaact gggtgtccca      1200
     gctggctaac ctcacacagg gcgaagacaa gtactacctt cgggtctcca ccgtgaccac      1260
     ccattcctct gactcagagg tcccctcccg tgtcactgag gtggtggtga agctgtttga      1320
     ctctgacccc atcacagtgg tgttaccaga agaagtctct aaggataacc ctaagtttat      1380
     ggacacagtg gcggagaagg cgctacagga ataccgcagg aaaagccgtg cggaatgaga      1440
     tagaagcatc accttcctat atgtaggagt gtctgggagg gaatctccca gctccccgag      1500
     gtggctgcag acccctagag aactccacat gtctccaggc gagtaggcct cacccaagca      1560
     gcctgccctt cctctggatt ctgtacacta atgcctgcac ttgctgctct cgggaagaac      1620
     tgattccccc acgcaactaa tccaataaaa gccgccttgc gatacgtgt                  1669
//