spacer

EBI Dbfetch

ID   L05631; SV 1; linear; mRNA; STD; MUS; 4231 BP.
XX
AC   L05631;
XX
DT   15-APR-1993 (Rel. 35, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mouse tyrosine kinase (TSK) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4231
RX   DOI; 10.1073/pnas.90.2.669.
RX   PUBMED; 8421704.
RA   Heyeck S.D., Berg L.J.;
RT   "Developmental regulation of a murine T-cell-specific tyrosine kinase gene,
RT   Tsk";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(2):669-673(1993).
XX
DR   MD5; bdba41e3fbf01402137524dbaa6518a8.
DR   Ensembl-Gn; ENSMUSG00000020395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109237; mus_musculus.
XX
CC   On Jun 12, 1993 this sequence version replaced gi:202251.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4231
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c x 129F2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..71
FT                   /gene="TSK"
FT   CDS             72..1931
FT                   /codon_start=1
FT                   /gene="TSK"
FT                   /product="tyrosine kinase"
FT                   /db_xref="GOA:Q03526"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="PDB:1AWJ"
FT                   /db_xref="PDB:1LUI"
FT                   /db_xref="PDB:1LUK"
FT                   /db_xref="PDB:1LUM"
FT                   /db_xref="PDB:1LUN"
FT                   /db_xref="PDB:2ETZ"
FT                   /db_xref="PDB:2EU0"
FT                   /db_xref="PDB:2K79"
FT                   /db_xref="PDB:2K7A"
FT                   /db_xref="PDB:2RN8"
FT                   /db_xref="PDB:2RNA"
FT                   /db_xref="PDB:3S9K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03526"
FT                   /protein_id="AAA40518.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   GKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDCESRQRWVL
FT                   TLKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPED
FT                   NRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAP
FT                   SSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKA
FT                   IISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSW
FT                   RQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSE
FT                   EDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETL
FT                   LGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGT
FT                   KFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRL
FT                   YKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL"
FT   3'UTR           1932..4231
FT                   /gene="TSK"
FT   polyA_signal    4211..4216
FT                   /gene="TSK"
XX
SQ   Sequence 4231 BP; 1100 A; 1058 C; 1036 G; 1037 T; 0 other;
     ccctgacgta gctctccttc agtcgcactg cggggtgatg cccaaggcgc atcacttttc        60
     agaactggac catgaacaac ttcatcctcc tggaagaaca gctgatcaag aagtcccaac       120
     agaagagaag gacttctccc tcgaatttta aagttcgttt ctttgtctta acgaaagcca       180
     gcctggccta ctttgaggac cgccacggga agaagcgcac gttgaagggc tccattgaac       240
     tctccagaat caagtgtgtg gagattgtca agagtgacat tagcatcccg tgccactata       300
     aatacccttt tcaggtcgtg catgacaact atctcctgta tgtgtttgct ccagactgtg       360
     agagtcggca gcgctgggtg ctgaccctta aagaagaaac gaggaataac aacagcctgg       420
     tatccaagta tcaccctaat ttctggatgg atgggcggtg gaggtgctgc tcccagctgg       480
     agaagcctgc tgtaggctgt gctccctacg acccatccaa gaatgcttca aagaagcctc       540
     ttcctcctac tcctgaagac aacaggcggt catttcagga acctgaagaa accctggtca       600
     ttgccttgta cgactaccaa accaacgacc ctcaggagct cgcgctgcgg tgtgatgaag       660
     agtactacct gctggacagc tccgagatcc actggtggag ggttcaagac aaaaatgggc       720
     atgaaggata tgcaccaagc agttacctgg tagaaaaatc tccaaataac cttgaaacct       780
     atgagtggta caataaaagc atcagccgcg acaaagctga aaaacttctt ttggacacag       840
     gtaaagaagg agctttcatg gtccgagatt ccaggacgcc cgggacatac acagtctctg       900
     ttttcaccaa ggccatcata agtgagaacc cctgtataaa acattatcac atcaaagaaa       960
     caaatgacag ccccaagcgc tactacgtgg ctgagaagta tgtgtttgac tccatccctc      1020
     tcctcatcca gtatcaccag tacaatggag gaggtttggt cactcgactc cgctatccag      1080
     tttgctcctg gagacaaaaa gcccctgtca cagcagggct aagatatggg aagtgggtga      1140
     tccaaccctc agagctaacg ttcgtgcagg agattggcag cgggcagttt gggctggtgc      1200
     atctcggcta ctggctcaac aaggacaagg tggccatcaa gaccattcag gaaggggcga      1260
     tgtcagaaga agactttatc gaggaggcgg aagtcatgat gaaactctct caccccaaac      1320
     tggtgcagct ctatggggtg tgcctggagc aagcccccat ctgcctggtg tttgagttca      1380
     tggagcacgg ctgcctgtcg gattaccttc gaagtcagcg gggtctcttt gctgcggaga      1440
     ccctgctggg catgtgcctg gatgtgtgtg agggcatggc ctacctggaa aaagcttgtg      1500
     tcatccacag agacctggca gccagaaact gtttggtggg agaaaaccag gtcatcaagg      1560
     tgtccgactt tgggatgaca agatttgtcc ttgatgatca atataccagc tccacgggca      1620
     ccaaattccc agtgaagtgg gcatccccag aggtgttctc ctttagtcgc tatagcagca      1680
     agtcagatgt gtggtcgttt ggtgtactga tgtgggaagt cttcagtgaa ggcaaaatcc      1740
     catacgaaaa ccgaagcaat tccgaggtcg tggaagatat cagcactggc tttcggttat      1800
     acaagccccg cctggcctcc tgtcatgtct accagatcat gaatcattgc tggaaagaga      1860
     aaccagaaga ccggccaccc ttctcccagc tgttaagcca gctggctgaa atcgcagaag      1920
     ctgggcttta gcagggactc attgaccaga cacagccata aatcctgagt gaaggaacaa      1980
     tgtccttttt ccagagcatt aaaagctgcc accagtccag aaacccccac aggtgcctgg      2040
     accatggtgc cagcactatg cagccacaac tgcagcatca tagaaaaggg tggagggcca      2100
     gccactgagc caacagctga accacaactg gagcagtatc tgcgtgtcca ccccatccca      2160
     gcctcttgtc gtatgctgta ctcaaagctc cattgcccac tctcgggagc atcccctccc      2220
     cctcttagca atcaggagag gcagacgtag gccacactct tctttattat tacttttaag      2280
     aataattcaa gtaaccttta atttggccca acgagacaat gtgcccattt tatggatgga      2340
     agagcgggaa agcatcattc tttttctaag aaatgcaaga ggtgattaaa ccagggtgtt      2400
     ctactacttc aaggctgtca gccacagctt cctgcctcac atgaggcgga gcggatgctt      2460
     gtgccagagg ccggatgcca taaggtttca gagcacactg ccacctctct ttgatggggc      2520
     acagagagct ccaggccggt gatagggcag ggtgacacat tcagacccca cggcaggacc      2580
     acaggatgtc tgaggtcggt caggaatgag agggcctctg atggtggaag taaagagtct      2640
     gcaaaagaag tcctttgggt tgttcctgac ccagcggccc tgtttcacgg tgagtcatgt      2700
     gtgtgactga tctcctgttc tgtgcaggat gctgaagcag tgactacaga acggtcatca      2760
     ttccagcctc tcaggagcgg catccactca gcactgtcat gatccttgtg actttgagac      2820
     tttgggttct ttcaagcctt tacgggttca gcagtcttaa ggttgccatg taaggctctc      2880
     aagagccagc aaaggaagaa ggcgtttgct cttgcccaaa ctatcaggaa ggaaagaggc      2940
     aagcactggg cggtgcttcc aaaatgcaca ggatgtctcc tactgattgg cactcgcaca      3000
     ggtgacatgt gtatatcctg cacacaggtc atccctggcg aatcacagtt cataccaacc      3060
     caaccacgag gtattattca tgtcttacag aaagtggact tggtctttta aaagctggat      3120
     agctgcccca gtgacagaac tgggaaggac ggagattgag atgacacccg aatataactc      3180
     cagtgtagcc tcttagctct tctcaatgct gcctcctact gaggttgggc cgctgagcca      3240
     taacacagga aagtctgggt taatgggcac cccaccccac agccaagttg ctcctactca      3300
     gagcactggg gggcccagtg ggaccctcca aattgaaata ggctgttctc tttcttcacc      3360
     ctcacctgga tctgagttca caaccctgga gccactcaaa attaaccctt tcattctccc      3420
     aacctaccag agtcacattg cctgaggcca tttatactag agcttcaaag gtgctttcaa      3480
     ctagtctcct gcagactgtt tcctgtaatt atcccttcaa cctagagctg gctctcttgt      3540
     gagaaggagg attccctggt gccaggcaca ctggattttc ctgcggtgtt cagacaaagc      3600
     ccctagaaaa atgatcagag tcacagatcc ctcttcctaa gtcacgtggc atttaggctg      3660
     gcttgaggct caaatgcatc acttccaact gtaatcactg tgtccagata aaactctgtc      3720
     attcagaaaa tgaacttcct caactggtcc acaatcatct ctgtttattc tcttttggga      3780
     aaccttaatt aagagacgat ttctgggaca tccaatctgg aagataaaca ctggaaccga      3840
     gagaagtctg tggtgtggtt taggagactg gcccccatac ggtggtattg gctctcttaa      3900
     cctcacatgc acgaaggctt tgatggacgc gtgtgcactg cttactccag tgtcctgctt      3960
     gggaagatgg gattctcttc tgctggtttc tgtcttacat tttttttgta aatggtgccc      4020
     tgtgttcaca gaaaggtttt ggtttgaaat gtattttgta ggccttgcaa ttcataatgt      4080
     ttggaactat gtatttatgc ctagatcagg agagtattta ttgcttgtct tcatgataaa      4140
     aaatactgca ggtatgtctt accctctgtg ggggccacaa gtcaatcatt gcttatggaa      4200
     aaaaatatat atataaagct acatgtttta c                                     4231
//


spacer
spacer